• Gene id: 84864

Gene Summary

• Gene Symbol: RIOX2   Gene   UCSC   Ensembl
• Aliases: JMJD10, MDIG, MINA, MINA53, NO52, ROX
• Gene name: ribosomal oxygenase 2
• Alternate names: ribosomal oxygenase 2, 60S ribosomal protein L27a histidine hydroxylase, MYC induced nuclear antigen, bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA, histone lysine demethylase MINA, mineral dust induced gene protein, myc-induced nuclear,
• Gene location: 3q11.2 (97972450: 97941816)     Exons: 13     NC_000003.12
• Gene summary(Entrez): MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008]
• OMIM: 612049

Protein Summary

• Protein general information: Q8IUF8  
  • Name: Ribosomal oxygenase 2 (60S ribosomal protein L27a histidine hydroxylase) (Bifunctional lysine specific demethylase and histidyl hydroxylase MINA) (EC 1.14.11. ) (Histone lysine demethylase MINA) (MYC induced nuclear antigen) (Mineral dust induced gene pro
  • Length: 465  
  • Mass: 52800
  • Tissue specificity: Expressed in liver, skeletal muscle, heart, pancreas, and placenta. Not detected in brain, lung or kidney. Expressed in several lung cancer tissues, but is barely detected in the adjacent non-cancerous tissues. Also highly expressed in
• Sequence:

  MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDDPALAT
  YYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQPQRFKDELWRI
  QEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYSVEAEERIGRPVHEFM
  LKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTAKEDVELRTGIPRQLLLQVES
  TTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAELSTPGGKLPRLDSVVRLQFKDHIVLT
  VLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKE
  SLVLSLWTECLIQVV

• Structural information:
  • Protein Domains: (139..27-)
    (/note="JmjC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00538"-)
  • Interpro: IPR003347  IPR039994  
  • Prosite: PS51184
  • PDB: 2XDV 4BU2 4BXF
  • PDBsum: 2XDV 4BU2 4BXF
  • DIP: 28141
  • STRING: ENSP00000328251
• Other Databases: GeneCards:  RIOX2  Malacards:  RIOX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051864	histone demethylase activity (H3-K36 specific)	IBA	molecular function
GO:0032453	histone demethylase activity (H3-K4 specific)	IBA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0070544	histone H3-K36 demethylation	IEA	biological process
GO:0034720	histone H3-K4 demethylation	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)