• Gene id: 84858

Gene Summary

• Gene Symbol: ZNF503   Gene   UCSC   Ensembl
• Aliases: NOLZ-1, NOLZ1, Nlz2
• Gene name: zinc finger protein 503
• Alternate names: zinc finger protein 503,
• Gene location: 10q22.2 (75401893: 75279725)     Exons: 5     NC_000010.11
• OMIM: 613902

Protein Summary

• Protein general information: Q96F45  
  • Name: Zinc finger protein 503
  • Length: 646  
  • Mass: 62555
• Sequence:

  MSTAPSLSALRSSKHSGGGGGGGGGGGADPAWTSALSGNSSGPGPGSSPAGSTKPFVHAVPPSDPLRQANRLPIK
  VLKMLTARTGHILHPEYLQPLPSTPVSPIELDAKKSPLALLAQTCSQIGKPDPSPSSKLSSVASNGGGAGGAGGG
  AAGDKDTKSGPLKLSDIGVEDKSSFKPYSKPGSDKKEPGGGGGGGGGGGGGGGGVSSEKSGFRVPSATCQPFTPR
  TGSPSSSASACSPGGMLSSAGGAPEGKDDKKDTDVGGGGKGTGGASAEGGPTGLAHGRISCGGGINVDVNQHPDG
  GPGGKALGSDCGGSSGSSSGSGPSAPTSSSVLGSGLVAPVSPYKPGQTVFPLPPAGMTYPGSLAGAYAGYPPQFL
  PHGVALDPTKPGSLVGAQLAAAAAGSLGCSKPAGSSPLAGASPPSVMTASLCRDPYCLSYHCASHLAGAAAASAS
  CAHDPAAAAAALKSGYPLVYPTHPLHGVHSSLTAAAAAGATPPSLAGHPLYPYGFMLPNDPLPHICNWVSANGPC
  DKRFATSEELLSHLRTHTAFPGTDKLLSGYPSSSSLASAAAAAMACHMHIPTSGAPGSPGTLALRSPHHALGLSS
  RYHPYSKSPLPTPGAPVPVPAATGPYYSPYALYGQRLTTASALGYQ

• Structural information:
  • Interpro: IPR022129  IPR013087  
  • Prosite: PS50157
  • STRING: ENSP00000361602
• Other Databases: GeneCards:  ZNF503  Malacards:  ZNF503

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070491	repressing transcription factor binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070315	G1 to G0 transition involved in cell differentiation	IEA	biological process
GO:0061351	neural precursor cell proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0070315	G1 to G0 transition involved in cell differentiation	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R