• Gene id: 84851

Gene Summary

• Gene Symbol: TRIM52   Gene   UCSC   Ensembl
• Aliases: RNF102
• Gene name: tripartite motif containing 52
• Alternate names: E3 ubiquitin-protein ligase TRIM52, tripartite motif-containing protein 52, RING finger protein 102,
• Gene location: 5q35.3 (181261354: 181249958)     Exons: 3     NC_000005.10
• OMIM: 617905

Protein Summary

• Protein general information: Q96A61  
  • Name: E3 ubiquitin protein ligase TRIM52 (EC 2.3.2.27) (RING finger protein 102) (Tripartite motif containing protein 52)
  • Length: 297  
  • Mass: 34653
• Sequence:

  MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEEAVGAM
  DGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLRPDLRIDVYRE
  EEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQMCPTPYRGNRSNDQG
  MCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ

• Structural information:
  • Interpro: IPR000315  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50119 PS00518 PS50089
  • CDD: cd00021
  • STRING: ENSP00000483005
• Other Databases: GeneCards:  TRIM52  Malacards:  TRIM52

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051607	defense response to virus	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0045087	innate immune response	IBA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0016604	nuclear body	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881