• Gene id: 8484

Gene Summary

• Gene Symbol: GALR3   Gene   UCSC   Ensembl
• Gene name: galanin receptor 3
• Alternate names: galanin receptor type 3, GAL3-R, GALR-3, galanin receptor, family member 3,
• Gene location: 22q13.1 (37823381: 37825484)     Exons: 2     NC_000022.11
• Gene summary(Entrez): The neuropeptide galanin modulates a variety of physiologic processes including cognition/memory, sensory/pain processing, hormone secretion, and feeding behavior. The human galanin receptors are G protein-coupled receptors that functionally couple to th
• OMIM: 609564

Protein Summary

• Protein general information: O60755  
  • Name: Galanin receptor type 3 (GAL3 R) (GALR 3)
  • Length: 368  
  • Mass: 39573
• Sequence:

  MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLFILNLAVADLCFILCC
  VPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDRYLAVRHPLRSRALRTPRNARAAVGLVWLLA
  ALFSAPYLSYYGTVRYGALELCVPAWEDARRRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEA
  RRRATGRAGRAMLAVAALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
  RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHGGEAARGPE

• Structural information:
  • Interpro: IPR000405  IPR003908  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000249041
• Other Databases: GeneCards:  GALR3  Malacards:  GALR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004966	galanin receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0017046	peptide hormone binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0004966	galanin receptor activity	IDA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004966	galanin receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0007194	negative regulation of adenylate cyclase activity	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004966	galanin receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007631	feeding behavior	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0007218	neuropeptide signaling pathway	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007611	learning or memory	TAS	biological process
GO:0005929	cilium	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0097731	9+0 non-motile cilium	IEA	cellular component
GO:0097730	non-motile cilium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007187	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IDA	biological process
GO:0017046	peptide hormone binding	IPI	molecular function
GO:0004966	galanin receptor activity	IDA	molecular function
GO:0090663	galanin-activated signaling pathway	IDA	biological process
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq