• Gene id: 84826

Gene Summary

• Gene Symbol: SFT2D3   Gene   UCSC   Ensembl
• Gene name: SFT2 domain containing 3
• Alternate names: vesicle transport protein SFT2C, SFT2 domain-containing protein 3,
• Gene location: 2q14.3 (127701496: 127705241)     Exons: 1     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: Q587I9  
  • Name: Vesicle transport protein SFT2C (SFT2 domain containing protein 3)
  • Length: 215  
  • Mass: 21790
• Sequence:

  MADLHRQLQEYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAESAAAGLTCLPSVTRGQ
  RLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALALAGSALLRGGAACGRLLRCEEAPSRPALLYM
  AALGATLFAALGLRSTLLTVLGAGAQVAALLAALVGLLPWGGGTALRLALGRLGRGAGLAKVLPV

• Structural information:
  • Interpro: IPR007305  IPR011691  
  • STRING: ENSP00000310803
• Other Databases: GeneCards:  SFT2D3  Malacards:  SFT2D3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray