• Gene id: 84816

Gene Summary

• Gene Symbol: RTN4IP1   Gene   UCSC   Ensembl
• Aliases: NIMP, OPA10
• Gene name: reticulon 4 interacting protein 1
• Alternate names: reticulon-4-interacting protein 1, mitochondrial, NOGO-interacting mitochondrial protein,
• Gene location: 6q21 (106630920: 106559236)     Exons: 13     NC_000006.12
• Gene summary(Entrez): This gene encodes a mitochondrial protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. This interaction may be important for reticulon-induced inhibition of neurite growth. Mutations in this ge
• OMIM: 610502

Protein Summary

• Protein general information: Q8WWV3  
  • Name: Reticulon 4 interacting protein 1, mitochondrial (NOGO interacting mitochondrial protein)
  • Length: 396  
  • Mass: 43590
  • Tissue specificity: Widely expressed in mitochondria-enriched tissues. Found in heart, muscle, kidney, liver, brain and placenta. {ECO
• Sequence:

  MEFLKTCVLRRNACTAVCFWRSKVVQKPSVRRISTTSPRSTVMPAWVIDKYGKNEVLRFTQNMMMPIIHYPNEVI
  VKVHAASVNPIDVNMRSGYGATALNMKRDPLHVKIKGEEFPLTLGRDVSGVVMECGLDVKYFKPGDEVWAAVPPW
  KQGTLSEFVVVSGNEVSHKPKSLTHTQAASLPYVALTAWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVM
  KAWDAHVTAVCSQDASELVRKLGADDVIDYKSGSVEEQLKSLKPFDFILDNVGGSTETWAPDFLKKWSGATYVTL
  VTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKV
  PEAFLKVERGHARGKTVINVV

• Structural information:
  • Interpro: IPR013154  IPR011032  IPR036291  IPR020843  IPR002364   IPR037397  
  • Prosite: PS01162
  • CDD: cd08248
  • PDB: 2VN8
  • PDBsum: 2VN8
  • STRING: ENSP00000358059
• Other Databases: GeneCards:  RTN4IP1  Malacards:  RTN4IP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005741	mitochondrial outer membrane	IDA	cellular component
GO:0050773	regulation of dendrite development	ISS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component

Diseases

Associated diseases	References
Optic atrophy	KEGG:H01020
Optic atrophy	KEGG:H01020
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881