Male Infertility Database

Search Result

Gene id

84814

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

PLPP7 Gene UCSC Ensembl

Aliases

C9orf67, NET39, PPAPDC3

Gene name

phospholipid phosphatase 7 (inactive)

Alternate names

inactive phospholipid phosphatase 7, epididymis secretory sperm binding protein, nuclear envelope transmembrane protein NET39, phosphatidic acid phosphatase type 2 domain containing 3, phosphatidic acid phosphatase type 2 domain-containing protein 3, probable ,

Gene location

9q34.13 (131289693: 131309260) Exons: 4 NC_000009.12

OMIM

618743

Protein Summary

Protein general information

Q8NBV4

Name: Inactive phospholipid phosphatase 7 (Phosphatidic acid phosphatase type 2 domain containing protein 3)

Length: 271 Mass: 29448

Sequence

MPASQSRARARDRNNVLNRAEFLSLNQPPKGGPEPRSSGRKASGPSAQPPPAGDGARERRQSQQLPEEDCMQLNP
SFKGIAFNSLLAIDICMSKRLGVCAGRAASWASARSMVKLIGITGHGIPWIGGTILCLVKSSTLAGQEVLMNLLL
ALLLDIMTVAGVQKLIKRRGPYETSPSLLDYLTMDIYAFPAGHASRAAMVSKFFLSHLVLAVPLRVLLVLWALCV
GLSRVMIGRHHVTDVLSGFVIGYLQFRLVELVWMPSSTCQMLISAW

Structural information

Interpro:	IPR036938 IPR000326
MINT:
STRING:	ENSP00000361338

Other Databases

GeneCards: PLPP7 Malacards: PLPP7

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0010832	negative regulation of my otube differentiation	IEA	biological process
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0005635	nuclear envelope	IBA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All