• Gene id: 84803

Gene Summary

• Gene Symbol: GPAT3   Gene   UCSC   Ensembl
• Aliases: AGPAT 10, AGPAT10, AGPAT8, AGPAT9, HMFN0839, LPAAT-theta, MAG1
• Gene name: glycerol-3-phosphate acyltransferase 3
• Alternate names: glycerol-3-phosphate acyltransferase 3, 1-AGP acyltransferase 9, 1-AGPAT 9, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10, 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9, 1-acylglycerol-3-phosphate O-acyltransferase 8, 1-acylglycerol-3-phosphate O-acy,
• Gene location: 4q21.23 (83535633: 83605874)     Exons: 16     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the lysophosphatidic acid acyltransferase protein family. The encoded protein is an enzyme which catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol. Multiple alternat
• OMIM: 618043

Protein Summary

• Protein general information: Q53EU6  
  • Name: Glycerol 3 phosphate acyltransferase 3 (GPAT 3) (EC 2.3.1.15) (1 acyl sn glycerol 3 phosphate O acyltransferase 10) (AGPAT 10) (1 acyl sn glycerol 3 phosphate O acyltransferase 9) (1 AGP acyltransferase 9) (1 AGPAT 9) (EC 2.3.1.51) (Acyl CoA:glycerol 3 ph
  • Length: 434  
  • Mass: 48705
  • Tissue specificity: Widely expressed. Expressed in liver, kidney, testis, brain, heart, skeletal muscle, thyroid, prostate, thymus and placenta. Also expressed lung and adipose tissue. {ECO
• Sequence:

  MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKESILKNSASVGIIQRD
  ESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISLRLTMVWVLGVI
  VRYCVLLPLRVTLAFIGISLLVIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGIC
  VANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILI
  FPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSWAIVCDVWYMPPMTRE
  EGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQKNYSKMIVGNGSLS

• Structural information:
  • Interpro: IPR002123  
  • STRING: ENSP00000482571
• Other Databases: GeneCards:  GPAT3  Malacards:  GPAT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004366	glycerol-3-phosphate O-acyltransferase activity	IDA	NOT|molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IDA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0102420	sn-1-glycerol-3-phosphate C16:0-DCA-CoA acyl transferase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0019432	triglyceride biosynthetic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0019432	triglyceride biosynthetic process	IEA	biological process
GO:0016024	CDP-diacylglycerol biosynthetic process	IEA	biological process
GO:0032006	regulation of TOR signaling	IDA	biological process
GO:0019432	triglyceride biosynthetic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0004366	glycerol-3-phosphate O-acyltransferase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00564	Glycerophospholipid metabolism
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881