• Gene id: 8480

Gene Summary

• Gene Symbol: RAE1   Gene   UCSC   Ensembl
• Aliases: Gle2, MIG14, MRNP41, Mnrp41, dJ481F12.3, dJ800J21.1
• Gene name: ribonucleic acid export 1
• Alternate names: mRNA export factor, RAE1 RNA export 1 homolog, homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer), mRNA export protein, mRNA-associated protein MRNP 41, mRNA-binding protein, 41-kD, migration-inducing gene 14, rae1 protein homolog,
• Gene location: 20q13.31 (57351238: 57379201)     Exons: 15     NC_000020.11
• Gene summary(Entrez): Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encod
• OMIM: 603343

Protein Summary

• Protein general information: P78406  
  • Name: mRNA export factor (Rae1 protein homolog) (mRNA associated protein mrnp 41)
  • Length: 368  
  • Mass: 40968
• Sequence:

  MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSG
  QTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWD
  KTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQ
  NKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
  DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

• Structural information:
  • Interpro: IPR020472  IPR037631  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 3MMY 4OWR
  • PDBsum: 3MMY 4OWR
  • DIP: 41063
  • STRING: ENSP00000379182
• Other Databases: GeneCards:  RAE1  Malacards:  RAE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000972	transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0005643	nuclear pore	IBA	cellular component
GO:0006405	RNA export from nucleus	IBA	biological process
GO:0097431	mitotic spindle pole	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:0006406	mRNA export from nucleus	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0005643	nuclear pore	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006409	tRNA export from nucleus	TAS	biological process
GO:0016032	viral process	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0060964	regulation of gene silencing by miRNA	TAS	biological process
GO:0006110	regulation of glycolytic process	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0005635	nuclear envelope	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0043657	host cell	IEA	cellular component
GO:0008017	microtubule binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa05164	Influenza A

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881