• Gene id: 84790

Gene Summary

• Gene Symbol: TUBA1C   Gene   UCSC   Ensembl
• Aliases: TUBA6, bcm948
• Gene name: tubulin alpha 1c
• Alternate names: tubulin alpha-1C chain, alpha-tubulin 6, tubulin alpha-6 chain, tubulin, alpha 6,
• Gene location: 12q13.12 (49227925: 49274599)     Exons: 7     NC_000012.12
• OMIM: 0

Protein Summary

• Protein general information: Q9BQE3  
  • Name: Tubulin alpha 1C chain (Alpha tubulin 6) (Tubulin alpha 6 chain) [Cleaved into: Detyrosinated tubulin alpha 1C chain]
  • Length: 449  
  • Mass: 49895
• Sequence:

  MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVI
  DEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFT
  SLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYT
  NLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPAN
  QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV
  CMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSADGEDEGEEY

• Structural information:
  • Interpro: IPR002452  IPR008280  IPR000217  IPR018316  IPR037103   IPR036525  IPR023123  IPR017975  IPR003008  
  • Prosite: PS00227
  • STRING: ENSP00000301072
• Other Databases: GeneCards:  TUBA1C  Malacards:  TUBA1C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007017	microtubule-based process	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0005874	microtubule	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005200	structural constituent of cytoskeleton	IBA	molecular function
GO:0000226	microtubule cytoskeleton organization	IBA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007017	microtubule-based process	IEA	biological process
GO:0005200	structural constituent of cytoskeleton	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005198	structural molecule activity	TAS	molecular function
GO:0007017	microtubule-based process	TAS	biological process
GO:0030705	cytoskeleton-dependent intracellular transport	TAS	biological process
GO:0051301	cell division	TAS	biological process
GO:0005874	microtubule	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031982	vesicle	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa05130	Pathogenic Escherichia coli infection
hsa04530	Tight junction
hsa04145	Phagosome
hsa04210	Apoptosis
hsa04540	Gap junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq