• Gene id: 8477

Gene Summary

• Gene Symbol: GPR65   Gene   UCSC   Ensembl
• Aliases: TDAG8, hTDAG8
• Gene name: G protein-coupled receptor 65
• Alternate names: psychosine receptor, T-cell death-associated gene 8 protein,
• Gene location: 14q31.3 (88005134: 88014810)     Exons: 2     NC_000014.9
• OMIM: 616338

Protein Summary

• Protein general information: Q8IYL9  
  • Name: Psychosine receptor (G protein coupled receptor 65) (T cell death associated gene 8 protein)
  • Length: 337  
  • Mass: 39333
  • Tissue specificity: Predominantly expressed in thymus, spleen, lymph nodes, small intestine, lung, placenta and peripheral blood leukocytes. {ECO
• Sequence:

  MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELGIYLFSLSLSDLLYALTLPLWIDYTW
  NKDNWTFSPALCKGSAFLMYMNFYSSTAFLTCIAVDRYLAVVYPLKFFFLRTRRFALMVSLSIWILETIFNAVML
  WEDETVVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAVRHNKATENKEKKRII
  KLLVSITVTFVLCFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTSLNCVADPILYCFVTETGRYD
  MWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR005464  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000267549
• Other Databases: GeneCards:  GPR65  Malacards:  GPR65

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0035025	positive regulation of Rho protein signal transduction	IBA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0010447	response to acidic pH	IDA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0051496	positive regulation of stress fiber assembly	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0031532	actin cytoskeleton reorganization	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R