• Gene id: 84769

Gene Summary

• Gene Symbol: MPV17L2   Gene   UCSC   Ensembl
• Aliases: FKSG24
• Gene name: MPV17 mitochondrial inner membrane protein like 2
• Alternate names: mpv17-like protein 2, MPV17 mitochondrial membrane protein-like 2,
• Gene location: 19p13.11 (18193217: 18196947)     Exons: 5     NC_000019.10
• OMIM: 615921

Protein Summary

• Protein general information: Q567V2  
  • Name: Mpv17 like protein 2
  • Length: 206  
  • Mass: 23180
• Sequence:

  MARGGWRRLRRLLSAGQLLFQGRALLVTNTLGCGALMAAGDGVRQSWEIRARPGQVFDPRRSASMFAVGCSMGPF
  LHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGCLEGQTVGESCQELREKFWEFYKADWCV
  WPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD

• Structural information:
  • Interpro: IPR007248  
  • STRING: ENSP00000469836
• Other Databases: GeneCards:  MPV17L2  Malacards:  MPV17L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061668	mitochondrial ribosome assembly	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0061668	mitochondrial ribosome assembly	IMP	biological process
GO:0070131	positive regulation of mitochondrial translation	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq