• Gene id: 84759

Gene Summary

• Gene Symbol: PCGF1   Gene   UCSC   Ensembl
• Aliases: 2010002K04Rik, NSPC1, RNF3A-2, RNF68
• Gene name: polycomb group ring finger 1
• Alternate names: polycomb group RING finger protein 1, RING finger protein 68, nervous system Polycomb-1,
• Gene location: 2p13.1 (507496: 519653)     Exons: 2     NC_000019.10
• Gene summary(Entrez): PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supp
• OMIM: 610231

Protein Summary

• Protein general information: Q9BSM1  
  • Name: Polycomb group RING finger protein 1 (Nervous system Polycomb 1) (NSPc1) (RING finger protein 68)
  • Length: 259  
  • Mass: 30346
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKY
  LQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGL
  PFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNE
  VLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR

• Structural information:
  • Interpro: IPR032443  IPR001841  IPR013083  IPR017907  
  • Prosite: PS00518 PS50089
  • PDB: 4HPL 4HPM 5JH5
  • PDBsum: 4HPL 4HPM 5JH5
  • DIP: 52708
  • STRING: ENSP00000233630
• Other Databases: GeneCards:  PCGF1  Malacards:  PCGF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035102	PRC1 complex	IBA	cellular component
GO:1990841	promoter-specific chromatin binding	IBA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006342	chromatin silencing	IBA	biological process
GO:0036353	histone H2A-K119 monoubiquitination	IBA	biological process
GO:0031519	PcG protein complex	IDA	cellular component
GO:0035518	histone H2A monoubiquitination	IDA	biological process
GO:0031519	PcG protein complex	IDA	cellular component
GO:0031519	PcG protein complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006355	regulation of transcription, DNA-templated	TAS	biological process
GO:0036353	histone H2A-K119 monoubiquitination	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04550	Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)