• Gene id: 8473

Gene Summary

• Gene Symbol: OGT   Gene   UCSC   Ensembl
• Aliases: HINCUT-1, HRNT1, MRX106, O-GLCNAC, OGT1
• Gene name: O-linked N-acetylglucosamine (GlcNAc) transferase
• Alternate names: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit, O-GlcNAc transferase p110 subunit, O-GlcNAc transferase subunit p110, O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminy,
• Gene location: Xq13.1 (71533103: 71575891)     Exons: 22     NC_000023.11
• Gene summary(Entrez): This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the
• OMIM: 300255

Protein Summary

• Protein general information: O15294  
  • Name: UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit (EC 2.4.1.255) (O GlcNAc transferase subunit p110) (O linked N acetylglucosamine transferase 110 kDa subunit) (OGT)
  • Length: 1046  
  • Mass: 116925
  • Tissue specificity: Highly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver. {ECO
• Sequence:

  MASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSA
  HFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSAL
  QYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFL
  DAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLA
  NALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQG
  KLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIA
  SYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNRLPSVHPHHSMLYPLSHGFRKAIAE
  RHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDFGNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTN
  FRVKVMAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMD
  YIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPD
  VKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPR
  TIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRI
  IFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGCLELIAKNRQE
  YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA

• Structural information:
  • Interpro: IPR037919  IPR029489  IPR013026  IPR011990  IPR001440   IPR019734  
  • Prosite: PS50005 PS50293
  • PDB: 1W3B 3PE3 3PE4 3TAX 4AY5 4AY6 4CDR 4GYW 4GYY 4GZ3 4GZ5 4GZ6 4N39 4N3A 4N3B 4N3C 4XI9 4XIF 5BNW 5C1D 5HGV 5LVV 5LWV 5NPR 5NPS 5VIE 5VIF 6E37 6EOU 6IBO 6MA1 6MA2 6MA3 6MA4 6MA5 6Q4M
  • PDBsum: 1W3B 3PE3 3PE4 3TAX 4AY5 4AY6 4CDR 4GYW 4GYY 4GZ3 4GZ5 4GZ6 4N39 4N3A 4N3B 4N3C 4XI9 4XIF 5BNW 5C1D 5HGV 5LVV 5LWV 5NPR 5NPS 5VIE 5VIF 6E37 6EOU 6IBO 6MA1 6MA2 6MA3 6MA4 6MA5 6Q4M
  • DIP: 33491
  • STRING: ENSP00000362824
• Other Databases: GeneCards:  OGT  Malacards:  OGT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016262	protein N-acetylglucosaminyltransferase activity	IBA	molecular function
GO:0006493	protein O-linked glycosylation	IBA	biological process
GO:0016262	protein N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0046626	regulation of insulin receptor signaling pathway	IDA	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0043995	histone acetyltransferase activity (H4-K5 specific)	IDA	contributes to
GO:0032868	response to insulin	IDA	biological process
GO:0016262	protein N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0016262	protein N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0016262	protein N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0016262	protein N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0016262	protein N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0016262	protein N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0016262	protein N-acetylglucosaminyltransferase activity	IDA	molecular function
GO:0006110	regulation of glycolytic process	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0006493	protein O-linked glycosylation	IDA	biological process
GO:0048015	phosphatidylinositol-mediated signaling	IDA	biological process
GO:0046972	histone acetyltransferase activity (H4-K16 specific)	IDA	contributes to
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043996	histone acetyltransferase activity (H4-K8 specific)	IDA	contributes to
GO:0043984	histone H4-K16 acetylation	IDA	biological process
GO:0043982	histone H4-K8 acetylation	IDA	biological process
GO:0043981	histone H4-K5 acetylation	IDA	biological process
GO:0035020	regulation of Rac protein signal transduction	IDA	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006493	protein O-linked glycosylation	IDA	biological process
GO:0006493	protein O-linked glycosylation	IDA	biological process
GO:0006493	protein O-linked glycosylation	IDA	biological process
GO:0006493	protein O-linked glycosylation	IDA	biological process
GO:0006493	protein O-linked glycosylation	IDA	biological process
GO:0006493	protein O-linked glycosylation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0000123	histone acetyltransferase complex	IDA	cellular component
GO:0017122	protein N-acetylglucosaminyltransferase complex	IDA	cellular component
GO:0016485	protein processing	IMP	biological process
GO:0080182	histone H3-K4 trimethylation	IMP	biological process
GO:0031397	negative regulation of protein ubiquitination	ISS	biological process
GO:0097363	protein O-GlcNAc transferase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097363	protein O-GlcNAc transferase activity	ISS	molecular function
GO:0006111	regulation of gluconeogenesis	ISS	biological process
GO:0061087	positive regulation of histone H3-K27 methylation	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0006493	protein O-linked glycosylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006493	protein O-linked glycosylation	IEA	biological process
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0008375	acetylglucosaminyltransferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007584	response to nutrient	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0006493	protein O-linked glycosylation	TAS	biological process
GO:0097363	protein O-GlcNAc transferase activity	IEA	molecular function
GO:0097363	protein O-GlcNAc transferase activity	IMP	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0097363	protein O-GlcNAc transferase activity	IEA	molecular function
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0006493	protein O-linked glycosylation	IEA	biological process
GO:0006111	regulation of gluconeogenesis	IEA	biological process
GO:0031397	negative regulation of protein ubiquitination	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IMP	biological process
GO:0031397	negative regulation of protein ubiquitination	IMP	biological process
GO:0016262	protein N-acetylglucosaminyltransferase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04931	Insulin resistance
hsa00514	Other types of O-glycan biosynthesis

Diseases

Associated diseases	References
Aortic valve stenosis	PMID:22128088
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Male infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray