• Gene id: 84727

Gene Summary

• Gene Symbol: SPSB2   Gene   UCSC   Ensembl
• Aliases: GRCC9, SSB2
• Gene name: splA/ryanodine receptor domain and SOCS box containing 2
• Alternate names: SPRY domain-containing SOCS box protein 2, SPRY domain-containing SOCS box protein SSB-2, gene-rich cluster protein C9,
• Gene location: 12p13.31 (6873302: 6870934)     Exons: 3     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of a subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal suppressor of cytokine signaling (SOCS) box. This protein plays a role in cell signaling. This gene is present in a gene-rich
• OMIM: 602536

Protein Summary

• Protein general information: Q99619  
  • Name: SPRY domain containing SOCS box protein 2 (SSB 2) (Gene rich cluster protein C9)
  • Length: 263  
  • Mass: 28630
• Sequence:

  MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQST
  DGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKLYHQSKGPGAP
  QYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPH
  SLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ

• Structural information:
  • Protein Domains: (26..22-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548-)
    (222..26-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR001870  IPR013320  IPR001496  IPR036036  IPR003877   IPR037340  
  • Prosite: PS50188 PS50225
  • CDD: cd03719
  • PDB: 3EMW 5XN3 6DN5 6DN6 6JKJ
  • PDBsum: 3EMW 5XN3 6DN5 6DN6 6JKJ
  • STRING: ENSP00000428338
• Other Databases: GeneCards:  SPSB2  Malacards:  SPSB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:1990756	ubiquitin ligase-substrate adaptor activity	IPI	molecular function
GO:1990756	ubiquitin ligase-substrate adaptor activity	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881