• Gene id: 84722

Gene Summary

• Gene Symbol: PSRC1   Gene   UCSC   Ensembl
• Aliases: DDA3, FP3214
• Gene name: proline and serine rich coiled-coil 1
• Alternate names: proline/serine-rich coiled-coil protein 1, differential display and activated by p53, p53-regulated DDA3, proline/serine-rich coiled-coil 1,
• Gene location: 1p13.3 (109283171: 109279553)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a proline-rich protein that is a target for regulation by the tumor suppressor protein p53. The encoded protein plays an important role in mitosis by recruiting and regulating microtubule depolymerases that destabalize microtubules. Alte
• OMIM: 604749

Protein Summary

• Protein general information: Q6PGN9  
  • Name: Proline/serine rich coiled coil protein 1
  • Length: 363  
  • Mass: 38796
  • Tissue specificity: Widely expressed in adult and fetal tissues, with highest expression in the adult brain and fetal thymus. Not detected in adult skeletal muscle. {ECO
• Sequence:

  MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLE
  EILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRS
  NDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASEETRAAKLRVSGS
  GEFVGLTLKFLHPSPPGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAKSSSQLPIPSAIPRPASRMPLTSRSVPPG
  RGALPPDSLSTRKGLPRPSTAGHRVRESGHKVPVSQRLNLPVMGATRSNLQPPRKVAVPGPTR

• Structural information:
  • Interpro: IPR026658  IPR026657  IPR032768  
  • STRING: ENSP00000358925
• Other Databases: GeneCards:  PSRC1  Malacards:  PSRC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007080	mitotic metaphase plate congression	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0060236	regulation of mitotic spindle organization	IDA	biological process
GO:0005876	spindle microtubule	IDA	colocalizes with
GO:0000922	spindle pole	IDA	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0031116	positive regulation of microtubule polymerization	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0009987	cellular process	IEA	biological process
GO:0030496	midbody	IEA	cellular component
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0008017	microtubule binding	ISS	molecular function
GO:0015630	microtubule cytoskeleton	ISS	cellular component
GO:0030308	negative regulation of cell growth	ISS	biological process
GO:0031116	positive regulation of microtubule polymerization	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0001578	microtubule bundle formation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005819	spindle	ISS	cellular component
GO:0030496	midbody	ISS	cellular component
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	ISS	biological process
GO:0005819	spindle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881