• Gene id: 84717

Gene Summary

• Gene Symbol: HDGFL2   Gene   UCSC   Ensembl
• Aliases: HDGF-2, HDGF2, HDGFRP2, HRP-2, HRP2
• Gene name: HDGF like 2
• Alternate names: hepatoma-derived growth factor-related protein 2, HDGF-related protein 2,
• Gene location: 19p13.3 (4472296: 4502219)     Exons: 17     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the hepatoma-derived growth factor (HDGF) family. The protein includes an N-terminal PWWP domain that binds to methyl-lysine-containing histones, with specific binding of this protein to tri-methylated lysines 36 and 79 of hi

Protein Summary

• Protein general information: Q7Z4V5  
  • Name: Hepatoma derived growth factor related protein 2 (HDGF related protein 2) (HRP 2) (Hepatoma derived growth factor 2) (HDGF 2)
  • Length: 671  
  • Mass: 74317
  • Tissue specificity: Widely expressed. High expression is found in heart, skeletal muscle, ovary and testis. Overexpression is frequently observed in hepatocellular carcinoma samples. {ECO
• Sequence:

  MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRK
  GFNEGLWEIQNNPHASYSAPPPVSSSDSEAPEANPADGSDADEDDEDRGVMAVTAVTATAASDRMESDSDSDKSS
  DNSGLKRKTPALKMSVSKRARKASSDLDQASVSPSEEENSESSSESEKTSDQDFTPEKKAAVRAPRRGPLGGRKK
  KKAPSASDSDSKADSDGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPLPKPRGRKPKPERPPSS
  SSSDSDSDEVDRISEWKRRDEARRRELEARRRREQEEELRRLREQEKEEKERRRERADRGEAERGSGGSSGDELR
  EDDEPVKKRGRKGRGRGPPSSSDSEPEAELEREAKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERT
  RKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALKVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKK
  IRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPSTDLSA
  PVNGEATSQKGESAEDKEHEEGRDSEEGPRCGSSEDLHDSVREGPDLDRPGSDRQERERARGDSEALDEES

• Structural information:
  • Protein Domains: (7..6-)
    (/note="PWWP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00162"-)
  • Interpro: IPR035496  IPR036218  IPR021567  IPR000313  IPR035441  
  • Prosite: PS50812
  • CDD: cd05834
  • PDB: 3EAE 3QBY 3QJ6
  • PDBsum: 3EAE 3QBY 3QJ6
  • STRING: ENSP00000483345
• Other Databases: GeneCards:  HDGFL2  Malacards:  HDGFL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0030307	positive regulation of cell growth	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray