• Gene id: 847

Gene Summary

• Gene Symbol: CAT   Gene   UCSC   Ensembl
• Gene name: catalase
• Alternate names: catalase,
• Gene location: 11p13 (27800528: 27756765)     Exons: 27     NC_000017.11
• Gene summary(Entrez): This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide t
• OMIM: 115500

SNPs

rs10848911

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.3705072G>A
NC_000012.12   g.3705072G>T
NC_000012.11   g.3814238G>A
NC_000012.11   g.3814238G>T|SEQ=[G/A/T]|GENE=CRACR2A

rs11857513

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.50497226G>A
NC_000015.10   g.50497226G>C
NC_000015.9   g.50789423G>A
NC_000015.9   g.50789423G>C
NG_047101.1   g.77850G>A
NG_047101.1   g.77850G>C
NM_001128610.2   c.3033G>A
NM_001128610.2   c.3033G>C
NM_001128610.3   c.3033G>A
NM_001128610.3   c.3033G>

Protein Summary

• Protein general information: P04040  
  • Name: Catalase (EC 1.11.1.6)
  • Length: 527  
  • Mass: 59,756
• Sequence:

  MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVH
  AKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNT
  PIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNA
  NGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLT
  KVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPV
  NCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNV
  LNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKA
  NL

• Structural information:
  • Interpro: IPR018028  IPR024708  IPR024711  IPR011614  IPR037060   IPR002226  IPR010582  IPR020835  
  • Prosite: PS00437 PS00438 PS51402
  • PDB: 1DGB 1DGF 1DGG 1DGH 1F4J 1QQW
  • PDBsum: 1DGB 1DGF 1DGG 1DGH 1F4J 1QQW
  • STRING: ENSP00000241052
• Other Databases: GeneCards:  CAT  Malacards:  CAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxygen species	IMP	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0001649	osteoblast differentiation	IDA	biological process
GO:0001657	ureteric bud development	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0004046	aminoacylase activity	IEA	molecular function
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005778	peroxisomal membrane	ISS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006195	purine nucleotide catabolic process	TAS	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0009060	aerobic respiration	IEA	biological process
GO:0009642	response to light intensity	IEA	biological process
GO:0009650	UV protection	IMP	biological process
GO:0009650	UV protection	IMP	biological process
GO:0010193	response to ozone	IEA	biological process
GO:0010288	response to lead ion	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014854	response to inactivity	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016209	antioxidant activity	IDA	molecular function
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0020027	hemoglobin metabolic process	IEA	biological process
GO:0020037	heme binding	IDA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0033197	response to vitamin E	IEA	biological process
GO:0033591	response to L-ascorbic acid	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IBA	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050661	NADP binding	IDA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0055093	response to hyperoxia	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070542	response to fatty acid	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0080184	response to phenylpropanoid	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0000302	response to reactive oxygen species	IEA	biological process
GO:0000302	response to reactive oxygen species	IMP	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0001649	osteoblast differentiation	IDA	biological process
GO:0001657	ureteric bud development	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0004046	aminoacylase activity	IEA	molecular function
GO:0004096	catalase activity	IEA	molecular function
GO:0004096	catalase activity	IEA	molecular function
GO:0004096	catalase activity	IEA	molecular function
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	TAS	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005778	peroxisomal membrane	ISS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006195	purine nucleotide catabolic process	TAS	biological process
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0009060	aerobic respiration	IEA	biological process
GO:0009314	response to radiation	IEA	biological process
GO:0009411	response to UV	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009642	response to light intensity	IEA	biological process
GO:0009650	UV protection	IMP	biological process
GO:0009650	UV protection	IMP	biological process
GO:0010193	response to ozone	IEA	biological process
GO:0010288	response to lead ion	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014854	response to inactivity	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016209	antioxidant activity	IDA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	IEA	molecular function
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0020027	hemoglobin metabolic process	IEA	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0033189	response to vitamin A	IEA	biological process
GO:0033197	response to vitamin E	IEA	biological process
GO:0033591	response to L-ascorbic acid	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IBA	biological process
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0046686	response to cadmium ion	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050661	NADP binding	IDA	molecular function
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0055093	response to hyperoxia	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070542	response to fatty acid	IEA	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0080184	response to phenylpropanoid	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0000302	response to reactive oxygen species	IMP	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0001649	osteoblast differentiation	IDA	biological process
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	IDA	molecular function
GO:0004096	catalase activity	TAS	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005102	receptor binding	IPI	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005778	peroxisomal membrane	ISS	cellular component
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006195	purine nucleotide catabolic process	TAS	biological process
GO:0009650	UV protection	IMP	biological process
GO:0009650	UV protection	IMP	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016209	antioxidant activity	IDA	molecular function
GO:0016684	oxidoreductase activity, acting on peroxide as acceptor	ISS	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0020037	heme binding	IDA	molecular function
GO:0042542	response to hydrogen peroxide	IBA	biological process
GO:0042744	hydrogen peroxide catabolic process	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0050661	NADP binding	IDA	molecular function
GO:0051262	protein tetramerization	IDA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051289	protein homotetramerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa04068	FoxO signaling pathway
hsa04146	Peroxisome
hsa04211	Longevity regulating pathway
hsa04213	Longevity regulating pathway - multiple species
hsa05014	Amyotrophic lateral sclerosis

Diseases

Associated diseases	References
Cancer (lymphoma)	GAD: 16956821
Cancer (prostate)	GAD: 17548672
Cancer	GAD: 17634480
Cancer (basal cell)	GAD: 20727719
Cancer (bladder)	GAD: 19692168
Cancer (brain)	GAD: 19505917
Cancer (colorectal)	GAD: 19622717
Cancer (head and neck)	GAD: 19584075
Cancer (Hepatocellular)	GAD: 19731237
Cancer (leukemia)	GAD: 19863340
Cancer (lung)	GAD: 19170196
Cancer (mouth)	GAD: 20643115
Cancer (breast)	GAD: 16192345
Atherosclerosis	GAD: 20485444
Cardiovascular disease	GAD: 20078877
Hypertension	GAD: 11479740
Acatalasemia	OMIM: 115500
Hyperkeratosis	GAD: 14580687
Gastric atrophy	GAD: 17549373
Diabetic neuropathy	GAD: 15125229
Macular degeneration	GAD: 15774926
Arthritis	GAD: 19242068
Asthma	GAD: 16385446
Pancreatitis	GAD: 15131792
Systemic lupus erythematosus (SLE)	GAD: 18368408
Diabetes	GAD: 12469627
Dyslipidemias	GAD: 19274593
Osteonecrosis	GAD: 18353692
Bone diseases	GAD: 17209132
Alzheimer's disease	GAD: 18248894
Hearing Loss	GAD: 17567781
Chronic renal failure	GAD: 21085059
Pregnancy complications	GAD: 20301895
Preeclampsia	INFBASE: 19399816
Varicocele	MIK: 22086312
Male factor infertility	MIK: 19288454
Endometriosis	INFBASE: 12372460
Adenomyosis	INFBASE: 12372460
Chronic obstructive pulmonary disease (COPD)	GAD: 19705749
Lung disease	GAD: 16467073
Vitiligo	GAD: 11837458
Albuminuria	GAD: 21180245
Male infertility	MIK: 19288454
Varicocele	MIK: 22086312

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22086312	Male infertility, varicocele			60 (48 varicocele patients, 12 non-varicocele inguinal hernia patients)	Male infertility
19288454	Male infertility			102 (9 normozoospermic, 13 azoospermic, 38 oligoasthenozoospermic, 42 asthenozoospermic )	Male infertility	CAT SOD
24456074	Male infertility	C-262T polymorphism		385 (195 men with idiopathic infertility, 190 healthy volunteers)	Male infertility
21443057	Male infertility			77 infertile and fertile healthy individuals	Male infertility	SOD CAT
26198800	Male infertility			218 (85 fertile, 133 patients treated for infertility)	Male infertility	SOD catalase