• Gene id: 84695

Gene Summary

• Gene Symbol: LOXL3   Gene   UCSC   Ensembl
• Aliases: LOXL
• Gene name: lysyl oxidase like 3
• Alternate names: lysyl oxidase homolog 3, lysyl oxidase-like protein 3,
• Gene location: 2p13.1 (74555718: 74532257)     Exons: 16     NC_000002.12
• Gene summary(Entrez): This gene encodes a lysyl oxidase, which likely functions as an amine oxidase and plays a role in the formation of crosslinks in collagens and elastin. Deletion of the related gene in mouse causes neonatal mortality with cleft palate, spine deformity, and

Protein Summary

• Protein general information: P58215  
  • Name: Lysyl oxidase homolog 3 (EC 1.4.3. ) (EC 1.4.3.13) (Lysyl oxidase like protein 3)
  • Length: 753  
  • Mass: 83166
  • Tissue specificity: Isoform 1
• Sequence:

  MRPVSVWQWSPWGLLLCLLCSSCLGSPSPSTGPEKKAGSQGLRFRLAGFPRKPYEGRVEIQRAGEWGTICDDDFT
  LQAAHILCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTEQSVTECASRGWGNSDCTHDEDAGVICKDQRLP
  GFSDSNVIEVEHHLQVEEVRIRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRV
  NAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTARCPGGGPAVVSCVPGPVYAASSGQKKQQQSK
  PQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGARMGQGMGAIHLSEVR
  CSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGAETRIRLSGGRSQHEGRVEVQIGGPGPLRWGLICGDDW
  GTLEAMVACRQLGLGYANHGLQETWYWDSGNITEVVMSGVRCTGTELSLDQCAHHGTHITCKRTGTRFTAGVICS
  ETASDLLLHSALVQETAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHS
  WVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITVGCWDLYRHDID
  CQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGHRIWVHNCHIGDAFSEEANRRFERYPGQTSN
  QII

• Structural information:
  • Protein Domains: (44..14-)
    (/note="SRCR-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (169..28-)
    (/note="SRCR-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (307..40-)
    (/note="SRCR-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (-)
  • Interpro: IPR001695  IPR019828  IPR001190  IPR017448  IPR036772  
  • Prosite: PS00926 PS00420 PS50287
  • STRING: ENSP00000264094
• Other Databases: GeneCards:  LOXL3  Malacards:  LOXL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004720	protein-lysine 6-oxidase activity	IBA	molecular function
GO:0006954	inflammatory response	IBA	biological process
GO:0030199	collagen fibril organization	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0018057	peptidyl-lysine oxidation	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0001837	epithelial to mesenchymal transition	IDA	biological process
GO:0018057	peptidyl-lysine oxidation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004720	protein-lysine 6-oxidase activity	IDA	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:2001046	positive regulation of integrin-mediated signaling pathway	ISS	biological process
GO:2000329	negative regulation of T-helper 17 cell lineage commitment	ISS	biological process
GO:1905590	fibronectin fibril organization	ISS	biological process
GO:0061053	somite development	ISS	biological process
GO:0021510	spinal cord development	ISS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001968	fibronectin binding	ISS	molecular function
GO:0060021	roof of mouth development	ISS	biological process
GO:0030324	lung development	ISS	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005507	copper ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016641	oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004720	protein-lysine 6-oxidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060021	roof of mouth development	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0004720	protein-lysine 6-oxidase activity	IEA	molecular function
GO:0001968	fibronectin binding	IEA	molecular function
GO:2001046	positive regulation of integrin-mediated signaling pathway	IEA	biological process
GO:2000329	negative regulation of T-helper 17 cell lineage commitment	IEA	biological process
GO:1905590	fibronectin fibril organization	IEA	biological process
GO:0061053	somite development	IEA	biological process
GO:0021510	spinal cord development	IEA	biological process
GO:0018057	peptidyl-lysine oxidation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0005507	copper ion binding	NAS	molecular function
GO:0004720	protein-lysine 6-oxidase activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881