• Gene id: 84690

Gene Summary

• Gene Symbol: SPATA22   Gene   UCSC   Ensembl
• Aliases: NYD-SP20, NYDSP20
• Gene name: spermatogenesis associated 22
• Alternate names: spermatogenesis-associated protein 22, testicular tissue protein Li 186, testis development protein NYD-SP20,
• Gene location: 17p13.2 (3513851: 3440010)     Exons: 10     NC_000017.11
• OMIM: 617673

Protein Summary

• Protein general information: Q8NHS9  
  • Name: Spermatogenesis associated protein 22 (Testis development protein NYD SP20)
  • Length: 363  
  • Mass: 41,318
• Sequence:

  MKRSLNENSARSTAGCLPVPLFNQKKRNRQPLTSNPLKDDSGISTPSDNYDFPPLPTDWAWEAVNPELAPVMKTV
  DTGQIPHSVSRPLRSQDSVFNSIQSNTGRSQGGWSYRDGNKNTSLKTWNKNDFKPQCKRTNLVANDGKNSCPVSS
  GAQQQKQLRIPEPPNLSRNKETELLRQTHSSKISGCTMRGLDKNSALQTLKPNFQQNQYKKQMLDDIPEDNTLKE
  TSLYQLQFKEKASSLRIISAVIESMKYWREHAQKTVLLFEVLAVLDSAVTPGPYYSKTFLMRDGKNTLPCVFYEI
  DRELPRLIRGRVHRCVGNYDQKKNIFQCVSVRPASVSEQKTFQAFVKIADVEMQYYINVMNET

• Structural information:
  • Interpro: IPR033536  
  • STRING: ENSP00000380354
• Other Databases: GeneCards:  SPATA22  Malacards:  SPATA22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000711	meiotic DNA repair synthesis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0007129	synapsis	IEA	biological process
GO:0007276	gamete generation	IEA	biological process
GO:0009566	fertilization	IEA	biological process
GO:0051445	regulation of meiotic cell cycle	IEA	biological process
GO:0061458	reproductive system development	IEA	biological process
GO:0000711	meiotic DNA repair synthesis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007129	synapsis	IEA	biological process
GO:0007276	gamete generation	IEA	biological process
GO:0009566	fertilization	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0051445	regulation of meiotic cell cycle	IEA	biological process
GO:0061458	reproductive system development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Sertoli cell only syndrome (SCOS)	MIK: 23675907
Maturation arrest	MIK: 23675907
Azoospermia	MIK: 20378615
Hypospermatogenesis	MIK: 23675907
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 30358834
Hypospermatogenesis (HS)	MIK: 23675907
Maturation arrest (MA)	MIK: 23675907
Sertoli cell-only syndrome (SCO)	MIK: 23675907
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23675907	Hypospermatogenesis (HS) maturation arrest (MA), Sertoli cell-only syndrome (SCO)				Male infertility	MND1 SPATA22 GAPDHS and ACR
30358834	Associated with spermatogenesis, Male infertility			64 (38 oligo-/oligoastheno-zoospermic infertile patients, 26 normozoospermic fertile men)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881