• Gene id: 84687

Gene Summary

• Gene Symbol: PPP1R9B   Gene   UCSC   Ensembl
• Aliases: PPP1R6, PPP1R9, SPINO, Spn
• Gene name: protein phosphatase 1 regulatory subunit 9B
• Alternate names: neurabin-2, neurabin-II, protein phosphatase 1, regulatory (inhibitor) subunit 9B, protein phosphatase 1, regulatory subunit 9B, spinophilin,
• Gene location: 17q21.33 (50150676: 50133736)     Exons: 10     NC_000017.11
• Gene summary(Entrez): This gene encodes a scaffold protein that functions as a regulatory subunit of protein phosphatase 1a. Expression of this gene is particularly high in dendritic spines, suggesting that the encoded protein may play a role in receiving signals from the cent
• OMIM: 603325

Protein Summary

• Protein general information: Q96SB3  
  • Name: Neurabin 2 (Neurabin II) (Protein phosphatase 1 regulatory subunit 9B) (Spinophilin)
  • Length: 817  
  • Mass: 89334
• Sequence:

  MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPDAPGPDEAPKGAHHKKYGSNVHRIKSMFLQMGTTAGPSGEAG
  GGAGLAEAPRASERGVRLSLPRASSLNENVDHSALLKLGTSVSERVSRFDSKPAPSAQPAPPPHPPSRLQETRKL
  FERSAPAAAGGDKEAAARRLLRQERAGLQDRKLDVVVRFNGSTEALDKLDADAVSPTVSQLSAVFEKADSRTGLH
  RGPGLPRAAGVPQVNSKLVSKRSRVFQPPPPPPPAPSGDAPAEKERCPAGQQPPQHRVAPARPPPKPREVRKIKP
  VEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAPEKEAAAVAPPERGVGNGRAPDVA
  PEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEDDEDDEEDGEPPYEPESGCVEIPGLSEEEDPAPSRKIH
  FSTAPIQVFSTYSNEDYDRRNEDVDPMAASAEYELEKRVERLELFPVELEKDSEGLGISIIGMGAGADMGLEKLG
  IFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLE
  QERWQREMMEQRYAQYGEDDEETGEYATDEDEELSPTFPGGEMAIEVFELAENEDALSPVDMEPEKLVHKFKELQ
  IKHAVTEAEIQQLKRKLQSLEQEKGRWRVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQA
  LERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST

• Structural information:
  • Protein Domains: (496..58-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR029921  IPR040645  IPR001478  IPR036034  
  • Prosite: PS50106
  • STRING: ENSP00000478767
• Other Databases: GeneCards:  PPP1R9B  Malacards:  PPP1R9B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007015	actin filament organization	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0031175	neuron projection development	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0032587	ruffle membrane	IDA	cellular component
GO:0030175	filopodium	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0016477	cell migration	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000474	regulation of opioid receptor signaling pathway	ISS	biological process
GO:0071315	cellular response to morphine	ISS	biological process
GO:0046847	filopodium assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008157	protein phosphatase 1 binding	IEA	molecular function
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990780	cytoplasmic side of dendritic spine plasma membrane	IEA	cellular component
GO:1904386	response to L-phenylalanine derivative	IEA	biological process
GO:1904373	response to kainic acid	IEA	biological process
GO:1903829	positive regulation of cellular protein localization	IEA	biological process
GO:1903119	protein localization to actin cytoskeleton	IEA	biological process
GO:0071392	cellular response to estradiol stimulus	IEA	biological process
GO:0060179	male mating behavior	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0048545	response to steroid hormone	IEA	biological process
GO:0044325	ion channel binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0035690	cellular response to drug	IEA	biological process
GO:0034695	response to prostaglandin E	IEA	biological process
GO:0032591	dendritic spine membrane	IEA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0031749	D2 dopamine receptor binding	IEA	molecular function
GO:0021766	hippocampus development	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0010243	response to organonitrogen compound	IEA	biological process
GO:0008157	protein phosphatase 1 binding	IEA	molecular function
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0007568	aging	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0003006	developmental process involved in reproduction	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0016358	dendrite development	IEA	biological process
GO:0007015	actin filament organization	IEA	biological process
GO:1990778	protein localization to cell periphery	IEA	biological process
GO:1904372	positive regulation of protein localization to actin cortical patch	IEA	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IEA	biological process
GO:1901653	cellular response to peptide	IEA	biological process
GO:0097338	response to clozapine	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IEA	biological process
GO:0061458	reproductive system development	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0044327	dendritic spine head	IEA	cellular component
GO:0044326	dendritic spine neck	IEA	cellular component
GO:0043200	response to amino acid	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0035902	response to immobilization stress	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0030042	actin filament depolymerization	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0019900	kinase binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007612	learning	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:2000474	regulation of opioid receptor signaling pathway	IEA	biological process
GO:0071315	cellular response to morphine	IEA	biological process
GO:0030864	cortical actin cytoskeleton	IEA	cellular component
GO:0019722	calcium-mediated signaling	IEA	biological process
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0008380	RNA splicing	NAS	biological process
GO:0042127	regulation of cell population proliferation	NAS	biological process
GO:0008157	protein phosphatase 1 binding	NAS	molecular function
GO:0007050	cell cycle arrest	TAS	biological process
GO:0005654	nucleoplasm	IMP	cellular component
GO:0004864	protein phosphatase inhibitor activity	NAS	molecular function
GO:0000164	protein phosphatase type 1 complex	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007096	regulation of exit from mitosis	NAS	biological process
GO:0001560	regulation of cell growth by extracellular stimulus	TAS	biological process

Diseases

Associated diseases	References
Alzheimer's disease	PMID:23764848
Schizophrenia	PMID:15465982
hepatocellular carcinoma	PMID:23591196
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq