• Gene id: 84675

Gene Summary

• Gene Symbol: TRIM55   Gene   UCSC   Ensembl
• Aliases: MURF-2, RNF29, muRF2
• Gene name: tripartite motif containing 55
• Alternate names: tripartite motif-containing protein 55, muscle specific ring finger 2, muscle-specific RING finger protein 2, ring finger protein 29,
• Gene location: 8q13.1 (66112666: 66175484)     Exons: 14     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transien
• OMIM: 613665

Protein Summary

• Protein general information: Q9BYV6  
  • Name: Tripartite motif containing protein 55 (Muscle specific RING finger protein 2) (MuRF 2) (MuRF2) (RING finger protein 29)
  • Length: 548  
  • Mass: 60466
  • Tissue specificity: Highly expressed in muscle. Low-level expression in liver. {ECO
• Sequence:

  MSASLNYKSFSKEQQTMDNLEKQLICPICLEMFTKPVVILPCQHNLCRKCASDIFQASNPYLPTRGGTTMASGGR
  FRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQPMCEEHEEERINIYCLNCEVPTCSLCKVF
  GAHKDCQVAPLTHVFQRQKSELSDGIAILVGSNDRVQGVISQLEDTCKTIEECCRKQKQELCEKFDYLYGILEER
  KNEMTQVITRTQEEKLEHVRALIKKYSDHLENVSKLVESGIQFMDEPEMAVFLQNAKTLLKKISEASKAFQMEKI
  EHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVGGEAVEVEEVENVQTEFPGEDENPEK
  ASELSQVELQAAPGALPVSSPEPPPALPPAADAPVTQGEVVPTGSEQTTESETPVPAAAETADPLFYPSWYKGQT
  RKATTNPPCTPGSEGLGQIGPPGSEDSNVRKAEVAAAAASERAAVSGKETSAPAATSQIGFEAPPLQGQAAAPAS
  GSGADSEPARHIFSFSWLNSLNE

• Structural information:
  • Protein Domains: (269..32-)
    (/note="COS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00586"-)
  • Interpro: IPR017903  IPR027370  IPR000315  IPR001841  IPR013083   IPR017907  
  • Prosite: PS51262 PS50119 PS00518 PS50089
  • CDD: cd00021
  • STRING: ENSP00000323913
• Other Databases: GeneCards:  TRIM55  Malacards:  TRIM55

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0005874	microtubule	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881