• Gene id: 84666

Gene Summary

• Gene Symbol: RETNLB   Gene   UCSC   Ensembl
• Aliases: FIZZ1, FIZZ2, HXCP2, RELM-beta, RELMb, RELMbeta, XCP2
• Gene name: resistin like beta
• Alternate names: resistin-like beta, C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 2, colon and small intestine-specific cysteine-rich protein, colon carcinoma-related gene protein, cysteine-rich secreted A12-alpha-like protein 1, cysteine-r,
• Gene location: 3q13.13 (108757282: 108755638)     Exons: 18     NC_000003.12
• OMIM: 605645

Protein Summary

• Protein general information: Q9BQ08  
  • Name: Resistin like beta (Colon and small intestine specific cysteine rich protein) (Colon carcinoma related gene protein) (Cysteine rich secreted protein A12 alpha like 1) (Cysteine rich secreted protein FIZZ2) (RELMbeta)
  • Length: 111  
  • Mass: 11730
  • Tissue specificity: Expressed only in the gastrointestinal tract, particularly the colon.
• Sequence:

  MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTG
  CACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

• Structural information:
  • Interpro: IPR009714  IPR036262  
  • CDD: cd16333
  • STRING: ENSP00000295755
• Other Databases: GeneCards:  RETNLB  Malacards:  RETNLB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0050673	epithelial cell proliferation	IEP	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)