• Gene id: 84659

Gene Summary

• Gene Symbol: RNASE7   Gene   UCSC   Ensembl
• Aliases: RAE1
• Gene name: ribonuclease A family member 7
• Alternate names: ribonuclease 7, RNase 7, SAP-2, ribonuclease, RNase A family, 7, skin-derived antimicrobial protein 2,
• Gene location: 14q11.2 (21042361: 21044232)     Exons: 2     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein has broad-spectrum antimicrobial activity against bacteria and fungi. [provided by RefSeq, Oct 2014]
• OMIM: 618626

Protein Summary

• Protein general information: Q9H1E1  
  • Name: Ribonuclease 7 (RNase 7) (EC 3.1.27. ) (Skin derived antimicrobial protein 2) (SAP 2)
  • Length: 156  
  • Mass: 17419
  • Tissue specificity: Expressed in collecting ducts in kidney, and in apical uroepithelium in bladder (at protein level) (PubMed
• Sequence:

  MAPARAGFCPLLLLLLLGLWVAEIPVSAKPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEP
  FSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPV
  HLDRVL

• Structural information:
  • Interpro: IPR001427  IPR036816  IPR023411  IPR023412  
  • Prosite: PS00127
  • PDB: 2HKY
  • PDBsum: 2HKY
  • STRING: ENSP00000298690
• Other Databases: GeneCards:  RNASE7  Malacards:  RNASE7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004540	ribonuclease activity	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0051673	membrane disruption in other organism	IDA	biological process
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0051673	membrane disruption in other organism	IDA	biological process
GO:0051673	membrane disruption in other organism	IDA	biological process
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0051673	membrane disruption in other organism	IDA	biological process
GO:0051673	membrane disruption in other organism	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050832	defense response to fungus	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0045087	innate immune response	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray