• Gene id: 84656

Gene Summary

• Gene Symbol: GLYR1   Gene   UCSC   Ensembl
• Aliases: BM045, HIBDL, N-PAC, NP60, hNDF
• Gene name: glyoxylate reductase 1 homolog
• Alternate names: putative oxidoreductase GLYR1, 3-hydroxyisobutyrate dehydrogenase-like protein, cytokine-like nuclear factor n-pac, nuclear protein 60 kDa, nuclear protein 60kDa, nuclear protein NP60, nuclear protein of 60 kDa, nucleosome-destabilizing factor,
• Gene location: 16p13.3 (4848031: 4803202)     Exons: 18     NC_000016.10
• OMIM: 610660

Protein Summary

• Protein general information: Q49A26  
  • Name: Putative oxidoreductase GLYR1 (EC 1. . . ) (3 hydroxyisobutyrate dehydrogenase like protein) (Cytokine like nuclear factor N PAC) (Glyoxylate reductase 1 homolog) (Nuclear protein NP60) (Nuclear protein of 60 kDa) (Nucleosome destabilizing factor) (hNDF)
  • Length: 553  
  • Mass: 60547
• Sequence:

  MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINK
  GKRFQQAVDAVEEFLRRAKGKDQTSSHNSSDDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNMGEGKKRVSSG
  SSERGSKSPLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHHFLLSQT
  EKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTA
  EKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVI
  VSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMAT
  IAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAA
  AANEVYKRAKALDQSDNDMSAVYRAYIH

• Structural information:
  • Protein Domains: (8..6-)
    (/note="PWWP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00162"-)
  • Interpro: IPR008927  IPR013328  IPR006115  IPR036291  IPR029154   IPR035501  IPR000313  
  • Prosite: PS50812
  • CDD: cd05836
  • PDB: 2UYY 4GUR 4GUS 4GUT 4GUU 4HSU 6R1U 6R25
  • PDBsum: 2UYY 4GUR 4GUS 4GUT 4GUU 4HSU 6R1U 6R25
  • STRING: ENSP00000322716
• Other Databases: GeneCards:  GLYR1  Malacards:  GLYR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035064	methylated histone binding	IBA	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA	NOT|molecular function
GO:0035064	methylated histone binding	IDA	molecular function
GO:0042393	histone binding	IDA	molecular function
GO:0000786	nucleosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050661	NADP binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051287	NAD binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035066	positive regulation of histone acetylation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0031491	nucleosome binding	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881