• Gene id: 84654

Gene Summary

• Gene Symbol: SPZ1   Gene   UCSC   Ensembl
• Aliases: CILD38, NYD-TSP1, PPP1R148
• Gene name: spermatogenic leucine zipper 1
• Alternate names: spermatogenic leucine zipper protein 1, protein phosphatase 1, regulatory subunit 148, spermatogenic zip 1, testis secretory sperm-binding protein Li 232m, testis-specific protein 1,
• Gene location: 5q14.1 (80320001: 80321841)     Exons: 1     NC_000005.10
• Gene summary(Entrez): This gene encodes a bHLH-zip transcription factor which functions in the mitogen-activate protein kinase (MAPK) signaling pathway. Because of its role in the upregulation of cell proliferation and tumorigenesis, this gene may serve as a target for Ras-ind
• OMIM: 618068

Protein Summary

• Protein general information: Q9BXG8  
  • Name: Spermatogenic leucine zipper protein 1 (Testis specific protein 1) (Testis specific protein NYD TSP1)
  • Length: 430  
  • Mass: 49445
  • Tissue specificity: Specifically and strongly expressed in the testis. Expressed in several tumor cell lines. {ECO
• Sequence:

  MASSAKSAEMPTISKTVNPTPDPHQEYLDPRITIALFEIGSHSPSSWGSLPFLKNSSHQVTEQQTAQKFNNLLKE
  IKDILKNMAGFEEKITEAKELFEETNITEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQEMILETNI
  TEDVSAHKENIRGLDKINEMLSTNLPVSLAPEKEDNEKKQQMIMENQNSENTAQVFARDLVNRLEEKKVLNETQQ
  SQEKAKNRLNVQEETMKIRNNMEQLLQEAEHWSKQHTELSKLIKSYQKSQKDISETLGNNGVGFQTQPNNEVSAK
  HELEEQVKKLSHDTYSLQLMAALLENECQILQQRVEILKELHHQKQGTLQEKPIQINYKQDKKNQKPSEAKKVEM
  YKQNKQAMKGTFWKKDRSCRSLDVCLNKKACNTQFNIHVARKALRGKMRSASSLR

• Structural information:
  • Interpro: IPR042961  
  • STRING: ENSP00000369611
• Other Databases: GeneCards:  SPZ1  Malacards:  SPZ1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process

Diseases

Associated diseases	References
Oligozoospermia	MIK: 21989496
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21989496	Oligozoospermia			11 (8 infertile and 3 fertile men)	Male infertility	Microarray