• Gene id: 84649

Gene Summary

• Gene Symbol: DGAT2   Gene   UCSC   Ensembl
• Aliases: ARAT, GS1999FULL, HMFN1045
• Gene name: diacylglycerol O-acyltransferase 2
• Alternate names: diacylglycerol O-acyltransferase 2, acyl-CoA retinol O-fatty-acyltransferase, diacylglycerol O-acyltransferase homolog 2, diacylglycerol O-acyltransferase-like protein 2, diglyceride acyltransferase 2,
• Gene location: 11q13.5 (113105772: 113120684)     Exons: 10     NC_000013.11
• Gene summary(Entrez): This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magne
• OMIM: 606983

Protein Summary

• Protein general information: Q96PD7  
  • Name: Diacylglycerol O acyltransferase 2 (EC 2.3.1.20) (Acyl CoA retinol O fatty acyltransferase) (ARAT) (Retinol O fatty acyltransferase) (EC 2.3.1.76) (Diglyceride acyltransferase 2)
  • Length: 388  
  • Mass: 43831
  • Tissue specificity: Predominantly expressed in liver and white adipose tissue. Expressed at lower level in mammary gland, testis and peripheral blood leukocytes. Expressed in sebaceous glands of normal skin but decreased psoriatic skin. {ECO
• Sequence:

  MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQ
  WVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNL
  LTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLL
  SKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
  KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKT
  KFGLPETEVLEVN

• Structural information:
  • Interpro: IPR007130  
  • STRING: ENSP00000228027
• Other Databases: GeneCards:  DGAT2  Malacards:  DGAT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008374	O-acyltransferase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0004144	diacylglycerol O-acyltransferase activity	IBA	molecular function
GO:0046339	diacylglycerol metabolic process	IBA	biological process
GO:0019432	triglyceride biosynthetic process	IBA	biological process
GO:0006629	lipid metabolic process	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005811	lipid droplet	IDA	cellular component
GO:0004144	diacylglycerol O-acyltransferase activity	IDA	molecular function
GO:0006640	monoacylglycerol biosynthetic process	IDA	biological process
GO:1990578	perinuclear endoplasmic reticulum membrane	IDA	cellular component
GO:0019432	triglyceride biosynthetic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006651	diacylglycerol biosynthetic process	ISS	biological process
GO:0016747	transferase activity, transferring acyl groups other than amino-acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006071	glycerol metabolic process	IEA	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004144	diacylglycerol O-acyltransferase activity	IEA	molecular function
GO:0050252	retinol O-fatty-acyltransferase activity	IEA	molecular function
GO:0004144	diacylglycerol O-acyltransferase activity	EXP	molecular function
GO:0019432	triglyceride biosynthetic process	TAS	biological process
GO:0036155	acylglycerol acyl-chain remodeling	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0097006	regulation of plasma lipoprotein particle levels	IEA	biological process
GO:0071400	cellular response to oleic acid	IEA	biological process
GO:0055089	fatty acid homeostasis	IEA	biological process
GO:0046339	diacylglycerol metabolic process	IEA	biological process
GO:0034383	low-density lipoprotein particle clearance	IEA	biological process
GO:0019915	lipid storage	IEA	biological process
GO:0019432	triglyceride biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0003846	2-acylglycerol O-acyltransferase activity	IEA	molecular function
GO:0046339	diacylglycerol metabolic process	IEA	biological process
GO:0046322	negative regulation of fatty acid oxidation	IEA	biological process
GO:0010867	positive regulation of triglyceride biosynthetic process	IEA	biological process
GO:0060613	fat pad development	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0035356	cellular triglyceride homeostasis	IEA	biological process
GO:0035336	long-chain fatty-acyl-CoA metabolic process	IEA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0004144	diacylglycerol O-acyltransferase activity	IEA	molecular function
GO:0090181	regulation of cholesterol metabolic process	IEA	biological process
GO:0050746	regulation of lipoprotein metabolic process	IEA	biological process
GO:0045722	positive regulation of gluconeogenesis	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0004144	diacylglycerol O-acyltransferase activity	IEA	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IC	cellular component
GO:0035336	long-chain fatty-acyl-CoA metabolic process	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0046339	diacylglycerol metabolic process	IDA	biological process
GO:0005811	lipid droplet	ISS	colocalizes with
GO:0030176	integral component of endoplasmic reticulum membrane	ISS	cellular component
GO:0035356	cellular triglyceride homeostasis	ISS	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0060613	fat pad development	ISS	biological process
GO:0005739	mitochondrion	ISS	colocalizes with
GO:0019915	lipid storage	ISS	biological process
GO:0034383	low-density lipoprotein particle clearance	ISS	biological process
GO:0055089	fatty acid homeostasis	ISS	biological process
GO:0071400	cellular response to oleic acid	ISS	biological process
GO:0097006	regulation of plasma lipoprotein particle levels	ISS	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0042572	retinol metabolic process	IEA	biological process
GO:0019432	triglyceride biosynthetic process	IEA	biological process
GO:0019432	triglyceride biosynthetic process	IDA	biological process
GO:0004144	diacylglycerol O-acyltransferase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00561	Glycerolipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Non-alcoholic fatty liver disease	PMID:17618857
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)