• Gene id: 84647

Gene Summary

• Gene Symbol: PLA2G12B   Gene   UCSC   Ensembl
• Aliases: FKSG71, GXIIB, GXIIIsPLA2, PLA2G13, sPLA2-GXIIB
• Gene name: phospholipase A2 group XIIB
• Alternate names: group XIIB secretory phospholipase A2-like protein, group XIII secreted phospholipase A2, phospholipase A2, group XIII,
• Gene location: 10q22.1 (72955043: 72934761)     Exons: 4     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the phospholipase A2 (PLA2) group of enzymes, which function in glycolipid hydrolysis with the release of free fatty acids and lysophospholipids. This family member has altered phospholipid-binding properties an
• OMIM: 606695

Protein Summary

• Protein general information: Q9BX93  
  • Name: Group XIIB secretory phospholipase A2 like protein (Group XIII secretory phospholipase A2 like protein) (GXIII sPLA2 like) (sPLA2 GXIIB) (GXIIB)
  • Length: 195  
  • Mass: 21659
  • Tissue specificity: Strong expression in liver, small intestine and kidney. {ECO
• Sequence:

  MKLASGFLVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPM
  PRPGYKPQEPNGCGSYFLGLKVPESMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGF
  VSKVEAACDSLVDTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL

• Structural information:
  • Interpro: IPR010711  IPR036444  
  • Prosite: PS00014
  • STRING: ENSP00000362123
• Other Databases: GeneCards:  PLA2G12B  Malacards:  PLA2G12B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070328	triglyceride homeostasis	IBA	biological process
GO:0042632	cholesterol homeostasis	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0050482	arachidonic acid secretion	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04014	Ras signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa00564	Glycerophospholipid metabolism
hsa04972	Pancreatic secretion
hsa00590	Arachidonic acid metabolism
hsa00565	Ether lipid metabolism
hsa04975	Fat digestion and absorption
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray