• Gene id: 8464

Gene Summary

• Gene Symbol: SUPT3H   Gene   UCSC   Ensembl
• Aliases: SPT3, SPT3L
• Gene name: SPT3 homolog, SAGA and STAGA complex component
• Alternate names: transcription initiation protein SPT3 homolog, SPT3-like protein, suppressor of Ty 3 homolog,
• Gene location: 6p21.1 (23578789: 23568037)     Exons: 7     NC_000014.9
• OMIM: 602947

Protein Summary

• Protein general information: O75486  
  • Name: Transcription initiation protein SPT3 homolog (SPT3 like protein)
  • Length: 317  
  • Mass: 35793
  • Tissue specificity: Expressed in all tissues tested including pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.
• Sequence:

  MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGA
  RVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKIAQDFLNSIDQTGEL
  LAMFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLA
  YETVAQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPL
  SPFTNAYRRNGMAFLAC

• Structural information:
  • Interpro: IPR009072  IPR003195  
  • CDD: cd07978
  • DIP: 28148
  • STRING: ENSP00000360515
• Other Databases: GeneCards:  SUPT3H  Malacards:  SUPT3H

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030914	STAGA complex	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0016578	histone deubiquitination	IDA	biological process
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray