• Gene id: 84639

Gene Summary

• Gene Symbol: IL1F10   Gene   UCSC   Ensembl
• Aliases: FIL1-theta, FKSG75, IL-1HY2, IL-38, IL1-theta, IL1HY2
• Gene name: interleukin 1 family member 10
• Alternate names: interleukin-1 family member 10, FIL1 theta, IL-1 theta, IL-1F10 (canonical form IL-1F10a), family of interleukin 1-theta, interleukin 1 family member 10 (theta), interleukin-1 HY2, interleukin-1 receptor antagonist FKSG75, interleukin-1 receptor antagonist-like F,
• Gene location: 2q14.1 (113067969: 113075842)     Exons: 5     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 fam
• OMIM: 615296

Protein Summary

• Protein general information: Q8WWZ1  
  • Name: Interleukin 1 family member 10 (IL 1F10) (Family of interleukin 1 theta) (FIL1 theta) (Interleukin 1 HY2) (IL 1HY2) (Interleukin 1 theta) (IL 1 theta) (Interleukin 38) (IL 38)
  • Length: 152  
  • Mass: 16943
  • Tissue specificity: Expressed in fetal skin, spleen and tonsil. Expressed mostly in the basal epithelia of skin and in proliferating B-cells of the tonsil.
• Sequence:

  MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLACVETEE
  GPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQ
  SW

• Structural information:
  • Interpro: IPR027164  IPR000975  IPR003297  IPR008996  
  • PDB: 5BOW
  • PDBsum: 5BOW
  • STRING: ENSP00000376893
• Other Databases: GeneCards:  IL1F10  Malacards:  IL1F10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0010628	positive regulation of gene expression	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005125	cytokine activity	IBA	molecular function
GO:0002437	inflammatory response to antigenic stimulus	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005149	interleukin-1 receptor binding	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)