• Gene id: 84631

Gene Summary

• Gene Symbol: SLITRK2   Gene   UCSC   Ensembl
• Aliases: CXorf1, CXorf2, SLITL1, TMEM257
• Gene name: SLIT and NTRK like family member 2
• Alternate names: SLIT and NTRK-like protein 2, slit and trk like gene 2, slit-like 1, transmembrane protein 257,
• Gene location: Xq27.3 (145817828: 145829855)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene encodes an integral membrane protein that contains two N-terminal leucine-rich repeats domains and contains C-terminal regions similar to neurotrophin receptors. The encoded protein may play a role in modulating neurite activity. Alternatively s
• OMIM: 617385

Protein Summary

• Protein general information: Q9H156  
  • Name: SLIT and NTRK like protein 2
  • Length: 845  
  • Mass: 95404
  • Tissue specificity: Expressed predominantly in the cerebral cortex of the brain but also at low levels in the spinal cord and medulla. Also expressed in some astrocytic brain tumors such as astrocytomas, oligodendrogliomas, glioblastomas, gangliogliomas a
• Sequence:

  MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPPQYRIYQLFLNGNLLT
  RLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLKTLKRLHLNNNKLEILREDTFLGLESLEYLQADYNYISAIE
  AGAFSKLNKLKVLILNDNLLLSLPSNVFRFVLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNCTCDLL
  PLKAWLDTITVFVGEIVCETPFRLHGKDVTQLTRQDLCPRKSASDSSQRGSHADTHVQRLSPTMNPALNPTRAPK
  ASRPPKMRNRPTPRVTVSKDRQSFGPIMVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQERKFTNISDLQPKPT
  SPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFTNLTSLRRLYLNGNYLEVLYPSMFDGLQSLQ
  YLYLEYNVIKEIKPLTFDALINLQLLFLNNNLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQID
  LQENPWDCTCDIMGLKDWTEHANSPVIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTVLSMNHNTDTPR
  SLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRNTNNLDVSSFQLQYGSYNTE
  THDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSYSNLEEKKEEPATPAYTISATELLEKQATPR
  EPELLYQNIAERVKELPSAGLVHYNFCTLPKRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPNHPLLQAK
  PQSEPDYLEVLEKQTAISQL

• Structural information:
  • Protein Domains: (216..26-)
    (/note="LRRCT-1)
    (331..37-)
    (/note="LRRNT-)
    (529..58-)
    (/note="LRRCT-2")
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • STRING: ENSP00000359521
• Other Databases: GeneCards:  SLITRK2  Malacards:  SLITRK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007409	axonogenesis	IBA	biological process
GO:0051965	positive regulation of synapse assembly	ISS	biological process
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0099560	synaptic membrane adhesion	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IDA	biological process
GO:1905606	regulation of presynapse assembly	IDA	biological process
GO:0099560	synaptic membrane adhesion	IDA	biological process
GO:0050807	regulation of synapse organization	IMP	biological process
GO:0050807	regulation of synapse organization	IMP	biological process
GO:0050807	regulation of synapse organization	IDA	biological process
GO:0050807	regulation of synapse organization	IDA	biological process
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0098982	GABA-ergic synapse	IDA	cellular component
GO:0098982	GABA-ergic synapse	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881