• Gene id: 84620

Gene Summary

• Gene Symbol: ST6GAL2   Gene   UCSC   Ensembl
• Aliases: SIAT2, ST6GalII
• Gene name: ST6 beta-galactoside alpha-2,6-sialyltransferase 2
• Alternate names: beta-galactoside alpha-2,6-sialyltransferase 2, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2, ST6 beta-galactosamide alpha-2,6-sialyltranferase 2, alpha 2,6-ST 2, beta-galactoside alpha-2,6-sialyltransferase II, sialyltransferase 2 ,
• Gene location: 2q12.3 (106887409: 106801599)     Exons: 10     NC_000002.12
• Gene summary(Entrez): This locus encodes a sialyltransferase. The encoded type II transmembrane protein catalyzes the transfer of sialic acid from CMP to an oligosaccharide substrate. Polymorphisms at this locus may be associated with variations in risperidone response in schi
• OMIM: 608472

Protein Summary

• Protein general information: Q96JF0  
  • Name: Beta galactoside alpha 2,6 sialyltransferase 2 (Alpha 2,6 ST 2) (EC 2.4.99.1) (CMP N acetylneuraminate beta galactosamide alpha 2,6 sialyltransferase 2) (ST6Gal II) (ST6GalII) (hST6Gal II) (Sialyltransferase 2)
  • Length: 529  
  • Mass: 60158
  • Tissue specificity: Weakly expressed in some tissues, such as small intestine, colon and fetal brain. {ECO
• Sequence:

  MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRAIMGAAHEPSPPGGLD
  ARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKSQSAFYPEDDDYFFAAGQPGWHSHTQGTLGF
  PSPGEPGPREGAFPAAQVQRRRVKKRHRRQRRSHVLEEGDDGDRLYSSMSRAFLYRLWKGNVSSKMLNPRLQKAM
  KDYLTANKHGVRFRGKREAGLSRAQLLCQLRSRARVRTLDGTEAPFSALGWRRLVPAVPLSQLHPRGLRSCAVVM
  SAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTIRIINSQILTNPSHHFIDSSLYKDVILVAWDPAPY
  SANLNLWYKKPDYNLFTPYIQHRQRNPNQPFYILHPKFIWQLWDIIQENTKEKIQPNPPSSGFIGILIMMSMCRE
  VHVYEYIPSVRQTELCHYHELYYDAACTLGAYHPLLYEKLLVQRLNMGTQGDLHRKGKVVLPGFQAVHCPAPSPV
  IPHS

• Structural information:
  • Interpro: IPR011330  IPR001675  IPR038578  
  • STRING: ENSP00000386942
• Other Databases: GeneCards:  ST6GAL2  Malacards:  ST6GAL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0009311	oligosaccharide metabolic process	IDA	biological process
GO:0003835	beta-galactoside alpha-2,6-sialyltransferase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis
hsa00514	Other types of O-glycan biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)