• Gene id: 8462

Gene Summary

• Gene Symbol: KLF11   Gene   UCSC   Ensembl
• Aliases: FKLF, FKLF1, MODY7, TIEG2, Tieg3
• Gene name: Kruppel like factor 11
• Alternate names: Krueppel-like factor 11, TGFB-inducible early growth response protein 2, TIEG-2, transforming growth factor-beta-inducible early growth response protein 2,
• Gene location: 2p25.1 (10043549: 10054835)     Exons: 8     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset
• OMIM: 603301

Protein Summary

• Protein general information: O14901  
  • Name: Krueppel like factor 11 (Transforming growth factor beta inducible early growth response protein 2) (TGFB inducible early growth response protein 2) (TIEG 2)
  • Length: 512  
  • Mass: 55139
  • Tissue specificity: Ubiquitous. Higher expression in erythroid cells. {ECO
• Sequence:

  MHTPDFAGPDDARAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPV
  SDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQSSAVVARALS
  GGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDSREGEEQLLGHFETLQDTHLTDSLLS
  TNLVSCQPCLHKSGGLLLTDKGQQAGWPGAVQTCSPKNYENDLPRKTTPLISVSVPAPPVLCQMIPVTGQSSMLP
  AFLKPPPQLSVGTVRPILAQAAPAPQPVFVGPAVPQGAVMLVLPQGALPPPAPCAANVMAAGNTKLLPLAPAPVF
  ITSSQNCVPQVDFSRRRNYVCSFPGCRKTYFKSSHLKAHLRTHTGEKPFNCSWDGCDKKFARSDELSRHRRTHTG
  EKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIPGWQAEVGKLNRIASAESPGSPLVSMPASA

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • PDB: 1PO4
  • PDBsum: 1PO4
  • STRING: ENSP00000307023
• Other Databases: GeneCards:  KLF11  Malacards:  KLF11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:1901653	cellular response to peptide	IEA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	molecular function
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Maturity onset diabetes of the young	KEGG:H00410
Maturity onset diabetes of the young	KEGG:H00410
type 2 diabetes mellitus	PMID:15774581
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)