• Gene id: 84612

Gene Summary

• Gene Symbol: PARD6B   Gene   UCSC   Ensembl
• Aliases: PAR6B
• Gene name: par-6 family cell polarity regulator beta
• Alternate names: partitioning defective 6 homolog beta, PAR-6 beta, par-6 partitioning defective 6 homolog beta,
• Gene location: 20q13.13 (50731579: 50753740)     Exons: 3     NC_000020.11
• Gene summary(Entrez): This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain, an OPR domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cytoplasmic protein is involved in asymmetrical cell division and cell pol

Protein Summary

• Protein general information: Q9BYG5  
  • Name: Partitioning defective 6 homolog beta (PAR 6 beta) (PAR 6B)
  • Length: 372  
  • Mass: 41182
  • Tissue specificity: Expressed in pancreas and in both adult and fetal kidney. Weakly expressed in placenta and lung. Not expressed in other tissues.
• Sequence:

  MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINND
  DNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDI
  LPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSG
  KSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIEPSFEPEDEDSEEDDIIIED
  NGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSNTEFETHAPDQKLLEEDGTIITL

• Structural information:
  • Protein Domains: (16..9-)
    (/note="PB1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01081-)
    (133..15-)
    (/note="Pseudo-CRIB-)
    (157..25-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR034873  IPR000270  IPR034868  IPR001478  IPR036034  
  • Prosite: PS51745 PS50106
  • CDD: cd06403
  • STRING: ENSP00000360672
• Other Databases: GeneCards:  PARD6B  Malacards:  PARD6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060341	regulation of cellular localization	IBA	biological process
GO:0017048	Rho GTPase binding	IBA	molecular function
GO:0005938	cell cortex	IBA	cellular component
GO:0005080	protein kinase C binding	IBA	molecular function
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0007098	centrosome cycle	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007043	cell-cell junction assembly	IEA	biological process
GO:0007163	establishment or maintenance of cell polarity	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0070830	bicellular tight junction assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0045177	apical part of cell	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0065003	protein-containing complex assembly	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0007043	cell-cell junction assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007409	axonogenesis	TAS	biological process
GO:0007163	establishment or maintenance of cell polarity	TAS	biological process
GO:0030334	regulation of cell migration	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa04144	Endocytosis
hsa04015	Rap1 signaling pathway
hsa04360	Axon guidance
hsa04530	Tight junction
hsa04390	Hippo signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)