• Gene id: 8460

Gene Summary

• Gene Symbol: TPST1   Gene   UCSC   Ensembl
• Aliases: TANGO13A
• Gene name: tyrosylprotein sulfotransferase 1
• Alternate names: protein-tyrosine sulfotransferase 1, TPST-1, transport and golgi organization 13 homolog A,
• Gene location: 7q11.21 (66205313: 66360442)     Exons: 8     NC_000007.14
• OMIM: 603125

Protein Summary

• Protein general information: O60507  
  • Name: Protein tyrosine sulfotransferase 1 (EC 2.8.2.20) (Tyrosylprotein sulfotransferase 1) (TPST 1)
  • Length: 370  
  • Mass: 42188
  • Tissue specificity: Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKLESTRTTVRTGLDLKANKTFAYHKDMPLIFIG
  GVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHG
  EPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQ
  CMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALS
  KWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE

• Structural information:
  • Interpro: IPR027417  IPR026634  
  • PDB: 5WRI 5WRJ
  • PDBsum: 5WRI 5WRJ
  • STRING: ENSP00000302413
• Other Databases: GeneCards:  TPST1  Malacards:  TPST1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0006478	peptidyl-tyrosine sulfation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0008476	protein-tyrosine sulfotransferase activity	IBA	molecular function
GO:0006478	peptidyl-tyrosine sulfation	IDA	biological process
GO:0030173	integral component of Golgi membrane	IDA	cellular component
GO:0008476	protein-tyrosine sulfotransferase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0006478	peptidyl-tyrosine sulfation	IEA	biological process
GO:0008476	protein-tyrosine sulfotransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008476	protein-tyrosine sulfotransferase activity	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0006478	peptidyl-tyrosine sulfation	TAS	biological process
GO:0008476	protein-tyrosine sulfotransferase activity	IEA	molecular function
GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0006478	peptidyl-tyrosine sulfation	IEA	biological process
GO:0008476	protein-tyrosine sulfotransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray