• Gene id: 84569

Gene Summary

• Gene Symbol: LYZL1   Gene   UCSC   Ensembl
• Aliases: KAAG648, LYC2, LYZD1, PRO1278, bA534G20.1
• Gene name: lysozyme like 1
• Alternate names: lysozyme-like protein 1, lysozyme D1,
• Gene location: 10p12.1-p11.23 (29289050: 29318327)     Exons: 10     NC_000010.11

Protein Summary

• Protein general information: Q6UWQ5  
  • Name: Lysozyme like protein 1 (EC 3.2.1.17)
  • Length: 148  
  • Mass: 16654
• Sequence:

  MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIF
  QINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSEWKKGCEVS

• Structural information:
  • Protein Domains: (20..14-)
    (/note="C-type-lysozyme)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00680"-)
  • Interpro: IPR001916  IPR019799  IPR000974  IPR023346  IPR030057  
  • Prosite: PS00128 PS51348
  • STRING: ENSP00000364650
• Other Databases: GeneCards:  LYZL1  Malacards:  LYZL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0003796	lysozyme activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008152	metabolic process	IEA	biological process
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0003796	lysozyme activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04970	Salivary secretion

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray