• Gene id: 84557

Gene Summary

• Gene Symbol: MAP1LC3A   Gene   UCSC   Ensembl
• Aliases: ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
• Gene name: microtubule associated protein 1 light chain 3 alpha
• Alternate names: microtubule-associated proteins 1A/1B light chain 3A, MAP1 light chain 3-like protein 1, MAP1A/1B light chain 3 A, MAP1A/MAP1B LC3 A, MAP1A/MAP1B light chain 3 A, autophagy-related ubiquitin-like modifier LC3 A, microtubule-associated proteins 1A/1B light chain,
• Gene location: 20q11.22 (49085450: 49108605)     Exons: 12     NC_000019.10
• Gene summary(Entrez): MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encod
• OMIM: 601242

Protein Summary

• Protein general information: Q9H492  
  • Name: Microtubule associated proteins 1A/1B light chain 3A (Autophagy related protein LC3 A) (Autophagy related ubiquitin like modifier LC3 A) (MAP1 light chain 3 like protein 1) (MAP1A/MAP1B light chain 3 A) (MAP1A/MAP1B LC3 A) (Microtubule associated protein
  • Length: 121  
  • Mass: 14272
  • Tissue specificity: Most abundant in heart, brain, liver, skeletal muscle and testis but absent in thymus and peripheral blood leukocytes. {ECO
• Sequence:

  MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNP
  TQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

• Structural information:
  • Interpro: IPR004241  IPR029071  
  • PDB: 3ECI 3WAL 3WAN 4ZDV 5CX3 5DPR
  • PDBsum: 3ECI 3WAL 3WAN 4ZDV 5CX3 5DPR
  • DIP: 49052
  • STRING: ENSP00000363970
• Other Databases: GeneCards:  MAP1LC3A  Malacards:  MAP1LC3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0006995	cellular response to nitrogen starvation	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0000045	autophagosome assembly	IBA	biological process
GO:0000421	autophagosome membrane	IBA	cellular component
GO:0000422	autophagy of mitochondrion	IBA	biological process
GO:0005776	autophagosome	IBA	cellular component
GO:0008429	phosphatidylethanolamine binding	IBA	molecular function
GO:0016236	macroautophagy	IBA	biological process
GO:0097352	autophagosome maturation	IBA	biological process
GO:0005776	autophagosome	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0044754	autolysosome	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0000422	autophagy of mitochondrion	IGI	biological process
GO:0000421	autophagosome membrane	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0097352	autophagosome maturation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043278	response to morphine	IEA	biological process
GO:0034198	cellular response to amino acid starvation	IEA	biological process
GO:0010288	response to lead ion	IEA	biological process
GO:0010040	response to iron(II) ion	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0071280	cellular response to copper ion	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0031667	response to nutrient levels	IEA	biological process
GO:0031090	organelle membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0000045	autophagosome assembly	IEA	biological process
GO:0005776	autophagosome	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0005543	phospholipid binding	IDA	molecular function
GO:0031090	organelle membrane	IDA	cellular component
GO:0008429	phosphatidylethanolamine binding	IDA	molecular function
GO:0005776	autophagosome	IDA	cellular component
GO:0016236	macroautophagy	IDA	biological process
GO:0005776	autophagosome	IDA	cellular component
GO:0097352	autophagosome maturation	IDA	biological process
GO:0009267	cellular response to starvation	IDA	biological process
GO:0000045	autophagosome assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04216	Ferroptosis

Diseases

Associated diseases	References
hypertrophic cardiomyopathy	PMID:25209900
Glioblastoma multiforme	PMID:24905460
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray