• Gene id: 84552

Gene Summary

• Gene Symbol: PARD6G   Gene   UCSC   Ensembl
• Aliases: PAR-6G, PAR6gamma
• Gene name: par-6 family cell polarity regulator gamma
• Alternate names: partitioning defective 6 homolog gamma, PAR-6 gamma protein, PAR6D, par-6 partitioning defective 6 homolog gamma,
• Gene location: 18q23 (80247513: 80157231)     Exons: 3     NC_000018.10

Protein Summary

• Protein general information: Q9BYG4  
  • Name: Partitioning defective 6 homolog gamma (PAR 6 gamma) (PAR6D)
  • Length: 376  
  • Mass: 40883
  • Tissue specificity: Widely expressed, with a higher expression in fetal and adult kidney.
• Sequence:

  MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYKLVVHTHHISNSDVTIGYADVHGDLLPIN
  NDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGALRDEGPRRRAHLDIGLPRDFRPVSSIIDVD
  LVPETHRRVRLHRHGCEKPLGFYIRDGASVRVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVA
  GKTLDQVTDMMIANSHNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDND
  VVIEGTLEPARPPQTPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLSSLRADPRHSLALPPGGVEEHGPAVT
  L

• Structural information:
  • Protein Domains: (18..9-)
    (/note="PB1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01081-)
    (134..15-)
    (/note="Pseudo-CRIB-)
    (158..25-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143"-)
  • Interpro: IPR034874  IPR000270  IPR034868  IPR001478  IPR036034  
  • Prosite: PS51745 PS50106
  • CDD: cd06403
  • STRING: ENSP00000343144
• Other Databases: GeneCards:  PARD6G  Malacards:  PARD6G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060341	regulation of cellular localization	IBA	biological process
GO:0017048	Rho GTPase binding	IBA	molecular function
GO:0005938	cell cortex	IBA	cellular component
GO:0005080	protein kinase C binding	IBA	molecular function
GO:0016324	apical plasma membrane	IBA	cellular component
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0007098	centrosome cycle	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0007163	establishment or maintenance of cell polarity	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070830	bicellular tight junction assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa04144	Endocytosis
hsa04015	Rap1 signaling pathway
hsa04360	Axon guidance
hsa04530	Tight junction
hsa04390	Hippo signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq