• Gene id: 84548

Gene Summary

• Gene Symbol: TMEM185A   Gene   UCSC   Ensembl
• Aliases: CXorf13, FAM11A, FRAXF, ee3
• Gene name: transmembrane protein 185A
• Alternate names: transmembrane protein 185A, family with sequence similarity 11, member A, fragile site, folic acid type, rare, fra(X)(q28) F,
• Gene location: Xq28 (149631911: 149596555)     Exons: 7     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is predicted to be a transmembrane protein. This gene is best known for localizing to the CpG island of the fragile site FRAXF. The 5' untranslated region of this gene contains a CGG trinucleotide repeat sequence that norm
• OMIM: 609603

Protein Summary

• Protein general information: Q8NFB2  
  • Name: Transmembrane protein 185A (Protein FAM11A)
  • Length: 350  
  • Mass: 40631
• Sequence:

  MNLRGLFQDFNPSKFLIYACLLLFSVLLALRLDGIIQWSYWAVFAPIWLWKLMVIVGASVGTGVWARNPQYRAEG
  ETCVEFKAMLIAVGIHLLLLMFEVLVCDRIERGSHFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNI
  LQFIFIALRLDKIIHWPWLVVCVPLWILMSFLCLVVLYYIVWSVLFLRSMDVIAEQRRTHITMALSWMTIVVPLL
  TFEILLVHKLDGHNAFSSIPIFVPLWLSLITLMATTFGQKGGNHWWFGIRKDFCQFLLEIFPFLREYGNISYDLH
  HEDNEETEETPVPEPPKIAPMFRKKARVVITQSPGKYVLPPPKLNIEMPD

• Structural information:
  • Interpro: IPR019396  
  • STRING: ENSP00000471932
• Other Databases: GeneCards:  TMEM185A  Malacards:  TMEM185A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030425	dendrite	IBA	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881