• Gene id: 84541

Gene Summary

• Gene Symbol: KBTBD8   Gene   UCSC   Ensembl
• Aliases: TA-KRP, TAKRP
• Gene name: kelch repeat and BTB domain containing 8
• Alternate names: kelch repeat and BTB domain-containing protein 8, T-cell activation kelch repeat protein, kelch repeat and BTB (POZ) domain containing 8,
• Gene location: 3p14.1 (66998306: 67011209)     Exons: 4     NC_000003.12
• OMIM: 610215

Protein Summary

• Protein general information: Q8NFY9  
  • Name: Kelch repeat and BTB domain containing protein 8 (T cell activation kelch repeat protein) (TA KRP)
  • Length: 601  
  • Mass: 68823
• Sequence:

  MAASADLSKSSPTPNGIPSSDPASDAMDPFHACSILKQLKTMYDEGQLTDIVVEVDHGKTFSCHRNVLAAISPYF
  RSMFTSGLTESTQKEVRIVGVEAESMDLVLNYAYTSRVILTEANVQALFTAASIFQIPSIQDQCAKYMISHLDPQ
  NSIGVFIFADHYGHQELGDRSKEYIRKKFLCVTKEQEFLQLTKDQLISILDSDDLNVDREEHVYESIIRWFEHEQ
  NEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGK
  KQTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSIDHKAENDFWMYDHSTNRWLSKPS
  LLRARIGCKLVYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENCWTTVCAMPVAMEFHNAVEYKEKIYVLQGEF
  FLFYEPQKDYWGFLTPMTVPRIQGLAAVYKDSIYYIAGTCGNHQRMFTVEAYDIELNKWTRKKDFPCDQSINPYL
  KLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSLYQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQKV
  L

• Structural information:
  • Protein Domains: (49..11-)
    (/note="BTB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00037-)
    (153..25-)
    (/note="BACK-)
    (/evidence="ECO:0000255"-)
  • Interpro: IPR011705  IPR017096  IPR000210  IPR028764  IPR015915   IPR006652  IPR011333  
  • Prosite: PS50097
  • STRING: ENSP00000401878
• Other Databases: GeneCards:  KBTBD8  Malacards:  KBTBD8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031463	Cul3-RING ubiquitin ligase complex	IDA	cellular component
GO:0006513	protein monoubiquitination	IDA	biological process
GO:0014032	neural crest cell development	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014029	neural crest formation	IMP	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881