Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 8454
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol CUL1   Gene   UCSC   Ensembl
Gene name cullin 1
Alternate names cullin-1, CUL-1,
Gene location 7q36.1 (148697755: 148801109)     Exons: 26     NC_000007.14
OMIM 603134

Protein Summary
Protein general information Q13616  

Name: Cullin 1 (CUL 1)

Length: 776  Mass: 89679

Tissue specificity: Expressed in lung fibroblasts. {ECO

Sequence MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKG
QTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECD
EGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTL
TVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHK
KYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVM
VVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHL
TNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGY
KNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIK
KCIDILIEKEYLERVDGEKDTYSYLA
Structural information
Interpro:  IPR016157  IPR016158  IPR036317  IPR001373  IPR019559  
IPR016159  IPR036388  IPR036390  
Prosite:   PS01256 PS50069

PDB:  		 1LDJ 1LDK 1U6G 3RTR 3TDU 3TDZ 4F52 4P5O 5V89
PDBsum:   1LDJ 1LDK 1U6G 3RTR 3TDU 3TDZ 4F52 4P5O 5V89

DIP:  
17013
MINT:  
STRING:   ENSP00000326804
Other Databases GeneCards:  CUL1  Malacards:  CUL1

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
 IPI molecular function
GO:1990452 Parkin-FBXW7-Cul1 ubiquit
in ligase complex
 IPI cellular component
GO:0004842 ubiquitin-protein transfe
rase activity
 IBA molecular function
GO:0006511 ubiquitin-dependent prote
in catabolic process
 IBA biological process
GO:0031461 cullin-RING ubiquitin lig
ase complex
 IBA cellular component
GO:0031625 ubiquitin protein ligase
binding
 IBA molecular function
GO:0016567 protein ubiquitination
 IBA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 IBA cellular component
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 IBA biological process
GO:0043161 proteasome-mediated ubiqu
itin-dependent protein ca
tabolic process
 IBA biological process
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 IDA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0016567 protein ubiquitination
 IDA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 ISS biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 ISS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0006511 ubiquitin-dependent prote
in catabolic process
 IEA biological process
GO:0031461 cullin-RING ubiquitin lig
ase complex
 IEA cellular component
GO:0031625 ubiquitin protein ligase
binding
 IEA molecular function
GO:0016032 viral process
 IEA biological process
GO:0000082 G1/S transition of mitoti
c cell cycle
 TAS biological process
GO:0097193 intrinsic apoptotic signa
ling pathway
 TAS biological process
GO:0031461 cullin-RING ubiquitin lig
ase complex
 IDA cellular component
GO:0010265 SCF complex assembly
 TAS biological process
GO:0010972 negative regulation of G2
/M transition of mitotic
cell cycle
 TAS biological process
GO:0010972 negative regulation of G2
/M transition of mitotic
cell cycle
 TAS biological process
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 TAS biological process
GO:0038061 NIK/NF-kappaB signaling
 TAS biological process
GO:0050852 T cell receptor signaling
pathway
 TAS biological process
GO:0070498 interleukin-1-mediated si
gnaling pathway
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0006879 cellular iron ion homeost
asis
 TAS biological process
GO:0016055 Wnt signaling pathway
 TAS biological process
GO:0038095 Fc-epsilon receptor signa
ling pathway
 TAS biological process
GO:0043687 post-translational protei
n modification
 TAS biological process
GO:0051403 stress-activated MAPK cas
cade
 TAS biological process
GO:1901990 regulation of mitotic cel
l cycle phase transition
 TAS biological process
GO:0000209 protein polyubiquitinatio
n
 TAS biological process
GO:0000086 G2/M transition of mitoti
c cell cycle
 TAS biological process
GO:0002223 stimulatory C-type lectin
receptor signaling pathw
ay
 TAS biological process
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0009887 animal organ morphogenesi
s
 IEA biological process
GO:0031146 SCF-dependent proteasomal
ubiquitin-dependent prot
ein catabolic process
 IEA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 IEA cellular component
GO:0008283 cell population prolifera
tion
 IEA biological process
GO:0006915 apoptotic process
 IEA biological process
GO:0006513 protein monoubiquitinatio
n
 IEA biological process
GO:0016567 protein ubiquitination
 IEA biological process
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0019005 SCF ubiquitin ligase comp
lex
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05200Pathways in cancer
hsa05131Shigellosis
hsa05170Human immunodeficiency virus 1 infection
hsa04141Protein processing in endoplasmic reticulum
hsa04310Wnt signaling pathway
hsa04120Ubiquitin mediated proteolysis
hsa04110Cell cycle
hsa04114Oocyte meiosis
hsa04350TGF-beta signaling pathway
hsa04340Hedgehog signaling pathway
hsa04710Circadian rhythm

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract
31037746 Spermatoge
nic defect
s
16 (1 control,
15 cases)
 Male infertility GSE6023 analyzed using GEO2R
 Show abstract