• Gene id: 84525

Gene Summary

• Gene Symbol: HOPX   Gene   UCSC   Ensembl
• Aliases: CAMEO, HOD, HOP, LAGY, NECC1, OB1, SMAP31, TOTO
• Gene name: HOP homeobox
• Alternate names: homeodomain-only protein, lung cancer-associated Y protein, not expressed in choriocarcinoma clone 1, odd homeobox protein 1,
• Gene location: 4q12 (56681865: 56647987)     Exons: 9     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of
• OMIM: 607275

Protein Summary

• Protein general information: Q9BPY8  
  • Name: Homeodomain only protein (Lung cancer associated Y protein) (Not expressed in choriocarcinoma protein 1) (Odd homeobox protein 1)
  • Length: 73  
  • Mass: 8260
  • Tissue specificity: Widely expressed. Expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen. Down-regulated in some types of cancer such as lung cancer, choriocarcinoma, head and neck squamo
• Sequence:

  MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

• Structural information:
  • Interpro: IPR009057  IPR001356  IPR039162  
  • Prosite: PS50071
  • CDD: cd00086
  • STRING: ENSP00000450527
• Other Databases: GeneCards:  HOPX  Malacards:  HOPX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0045596	negative regulation of cell differentiation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0001829	trophectodermal cell differentiation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0051131	chaperone-mediated protein complex assembly	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)