• Gene id: 84519

Gene Summary

• Gene Symbol: ACRBP   Gene   UCSC   Ensembl
• Aliases: CT23, OY-TES-1, SP32
• Gene name: acrosin binding protein
• Alternate names: acrosin-binding protein, acrosin-binding protein, 60 kDa form, cancer/testis antigen 23, cancer/testis antigen OY-TES-1, proacrosin binding protein sp32, testicular tissue protein Li 10,
• Gene location: 12p13.31 (6647431: 6638074)     Exons: 4     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and con
• OMIM: 608352

Protein Summary

• Protein general information: Q8NEB7  
  • Name: Acrosin binding protein (Acrosin binding protein, 60 kDa form) (Cancer/testis antigen 23) (CT23) (Cancer/testis antigen OY TES 1) (Proacrosin binding protein sp32) [Cleaved into: Acrosin binding protein, mature form (Acrosin binding protein, 32 kDa form,
  • Length: 543  
  • Mass: 61359
  • Tissue specificity: Expression restricted to testis in normal tissue. Expressed in a wide spectrum of cancers, including bladder, breast, liver, lung and colon cancers. {ECO
• Sequence:

  MRKPAAGFLPSLLKVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLRATHGCRNPTLVQ
  LDQYENHGLVPDGAVCSNLPYASWFESFCQFTHYRCSNHVYYAKRVLCSQPVSILSPNTLKEIEASAEVSPTTMT
  SPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQEEGQKQEEQEEE
  QEEEGKQEEGQGTKEGREAVSQLQTDSEPKFHSESLSSNPSSFAPRVREVESTPMIMENIQELIRSAQEIDEMNE
  IYDENSYWRNQNPGSLLQLPHTEALLVLCYSIVENTCIITPTAKAWKYMEEEILGFGKSVCDSLGRRHMSTCALC
  DFCSLKLEQCHSEASLQRQQCDTSHKTPFVSPLLASQSLSIGNQVGSPESGRFYGLDLYGGLHMDFWCARLATKG
  CEDVRVSGWLQTEFLSFQDGDFPTKICDTDYIQYPNYCSFKSQQCLMRNRNRKVSRMRCLQNETYSALSPGKSED
  VVLRWSQEFSTLTLGQFG

• Structural information:
  • Interpro: IPR036058  IPR009865  
  • STRING: ENSP00000229243
• Other Databases: GeneCards:  ACRBP  Malacards:  ACRBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001669	acrosomal vesicle	IBA	cellular component
GO:0005576	extracellular region	ISS	cellular component
GO:0009566	fertilization	ISS	biological process
GO:0007286	spermatid development	ISS	biological process
GO:0002080	acrosomal membrane	ISS	cellular component
GO:0001669	acrosomal vesicle	ISS	cellular component
GO:0001675	acrosome assembly	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0007286	spermatid development	IEA	biological process
GO:0009566	fertilization	IEA	biological process
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0001675	acrosome assembly	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray