• Gene id: 84516

Gene Summary

• Gene Symbol: DCTN5   Gene   UCSC   Ensembl
• Gene name: dynactin subunit 5
• Alternate names: dynactin subunit 5, dynactin 4, dynactin 5 (p25), dynactin subunit p25,
• Gene location: 16p12.2 (76444927: 76553030)     Exons: 23     NC_000011.10
• Gene summary(Entrez): This gene encodes a subunit of dynactin, a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end subcomplex and is thought to bind membranous cargo. A pseudogene
• OMIM: 612962

Protein Summary

• Protein general information: Q9BTE1  
  • Name: Dynactin subunit 5 (Dynactin subunit p25)
  • Length: 182  
  • Mass: 20127
• Sequence:

  MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKK
  FSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCP
  GLFSGELPECTQELMIDVTKSYYQKFLPLTQV

• Structural information:
  • Interpro: IPR001451  IPR011004  
  • PDB: 5NW4
  • PDBsum: 5NW4
  • STRING: ENSP00000300087
• Other Databases: GeneCards:  DCTN5  Malacards:  DCTN5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005813	centrosome	IDA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060976	coronary vasculature development	IEA	biological process
GO:0035904	aorta development	IEA	biological process
GO:0003281	ventricular septum development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881