• Gene id: 8446

Gene Summary

• Gene Symbol: DUSP11   Gene   UCSC   Ensembl
• Aliases: PIR1
• Gene name: dual specificity phosphatase 11
• Alternate names: RNA/RNP complex-1-interacting phosphatase, RNA/RNP complex 1-interacting, RNA/RNP complex-interacting phosphatase, dual specificity protein phosphatase 11, phosphatase that interacts with RNA/RNP complex 1, serine/threonine specific protein phosphatase,
• Gene location: 2p13.1 (73780156: 73762197)     Exons: 9     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regu
• OMIM: 603092

Protein Summary

• Protein general information: O75319  
  • Name: RNA/RNP complex 1 interacting phosphatase (EC 3.1.3. ) (Dual specificity protein phosphatase 11) (Phosphatase that interacts with RNA/RNP complex 1)
  • Length: 377  
  • Mass: 43710
• Sequence:

  MRNSETLERGVGGCRVFSCLGSYPGIEGAGLALLADLALGGRLLGTHMSQWHHPRSGWGRRRDFSGRSSAKKKGG
  NHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPE
  DLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDA
  IELFNRCRGHCLERQNYIEDLQNGPIRKNWNSSVPRSSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHF
  HTQTQSLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEW
  TQ

• Structural information:
  • Protein Domains: (175..24-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR000340  IPR029021  IPR016130  IPR000387  IPR020422  
  • Prosite: PS00383 PS50056
  • PDB: 4JMJ 4MBB 4NYH
  • PDBsum: 4JMJ 4MBB 4NYH
  • STRING: ENSP00000272444
• Other Databases: GeneCards:  DUSP11  Malacards:  DUSP11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004651	polynucleotide 5'-phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0098507	polynucleotide 5' dephosphorylation	IDA	biological process
GO:0016070	RNA metabolic process	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0016607	nuclear speck	IDA	cellular component
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004651	polynucleotide 5'-phosphatase activity	IDA	molecular function
GO:0098519	nucleotide phosphatase activity, acting on free nucleotides	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006396	RNA processing	TAS	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881