• Gene id: 8445

Gene Summary

• Gene Symbol: DYRK2   Gene   UCSC   Ensembl
• Gene name: dual specificity tyrosine phosphorylation regulated kinase 2
• Alternate names: dual specificity tyrosine-phosphorylation-regulated kinase 2, dual specificity tyrosine-(Y)-phosphorylation regulated kinase 2,
• Gene location: 12q15 (67648744: 67665405)     Exons: 4     NC_000012.12
• Gene summary(Entrez): DYRK2 belongs to a family of protein kinases whose members are presumed to be involved in cellular growth and/or development. The family is defined by structural similarity of their kinase domains and their capability to autophosphorylate on tyrosine re
• OMIM: 603496

Protein Summary

• Protein general information: Q92630  
  • Name: Dual specificity tyrosine phosphorylation regulated kinase 2 (EC 2.7.12.1)
  • Length: 601  
  • Mass: 66652
  • Tissue specificity: Testis, after the onset of spermatogenesis. {ECO
• Sequence:

  MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNAAAAAHTIGGSKHTMN
  DHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSLKSMEGMGKVK
  ATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYEVL
  KVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDNTMNVIHMLENFTFRNHICMT
  FELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYE
  HQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACMIELLGMPSQKLLDASK
  RAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMT
  PGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAITSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLV
  S

• Structural information:
  • Protein Domains: (222..53-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR042521  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 3K2L 3KVW 4AZF 5LXC 5LXD 5ZTN 6HDP 6HDR 6K0J
  • PDBsum: 3K2L 3KVW 4AZF 5LXC 5LXD 5ZTN 6HDP 6HDR 6K0J
  • STRING: ENSP00000342105
• Other Databases: GeneCards:  DYRK2  Malacards:  DYRK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0018107	peptidyl-threonine phosphorylation	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0070885	negative regulation of calcineurin-NFAT signaling cascade	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IEP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004712	protein serine/threonine/tyrosine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0045725	positive regulation of glycogen biosynthetic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0030145	manganese ion binding	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0007224	smoothened signaling pathway	IMP	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R