• Gene id: 84440

Gene Summary

• Gene Symbol: RAB11FIP4   Gene   UCSC   Ensembl
• Aliases: FIP4-Rab11, RAB11-FIP4
• Gene name: RAB11 family interacting protein 4
• Alternate names: rab11 family-interacting protein 4, RAB11 family interacting protein 4 (class II), arfophilin-2,
• Gene location: 17q11.2 (9004650: 8980575)     Exons: 9     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene interacts with RAB11 and is thought to be involved in bringing recycling endosome membranes to the cleavage furrow in late cytokinesis. Hypoxic conditions can lead to an upregulation of the encoded protein and enhance the
• OMIM: 611999

Protein Summary

• Protein general information: Q86YS3  
  • Name: Rab11 family interacting protein 4 (FIP4 Rab11) (Rab11 FIP4) (Arfophilin 2)
  • Length: 637  
  • Mass: 71928
  • Tissue specificity: Present at high level in testis (at protein level). Weakly expressed in other tissues. {ECO
• Sequence:

  MAGGAGWSGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKYLDPNDLGRINFKDFC
  RGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEEAMTLAPPEGP
  QELYTDSPMESTQSLEGSVGSPAEKDGGLGGLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEGDDV
  DCAPSSPCPDDETRTNVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPN
  RKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLTNGDLKSKLKQENTQL
  VHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVELLNARVQQLEEENTELRTTVTRLKSQTEKL
  DEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRS
  ASSGLGEFNARAREVELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDEL
  MEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH

• Structural information:
  • Protein Domains: (49..8-)
    (/note="EF-hand-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (574..63-)
    (/note="FIP-RBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00844"-)
  • Interpro: IPR011992  IPR002048  IPR037245  IPR019018  
  • Prosite: PS50222 PS51511
  • DIP: 47495
  • STRING: ENSP00000482620
• Other Databases: GeneCards:  RAB11FIP4  Malacards:  RAB11FIP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032465	regulation of cytokinesis	IBA	biological process
GO:0032154	cleavage furrow	IBA	cellular component
GO:0030496	midbody	IBA	cellular component
GO:0030139	endocytic vesicle	IBA	cellular component
GO:0055038	recycling endosome membrane	IBA	cellular component
GO:0032456	endocytic recycling	IBA	biological process
GO:0030306	ADP-ribosylation factor binding	IBA	molecular function
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0005813	centrosome	IBA	colocalizes with
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0032154	cleavage furrow	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0030306	ADP-ribosylation factor binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0003407	neural retina development	IEA	biological process
GO:1903452	positive regulation of G1 to G0 transition	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq