• Gene id: 8444

Gene Summary

• Gene Symbol: DYRK3   Gene   UCSC   Ensembl
• Aliases: DYRK5, RED, REDK, hYAK3-2
• Gene name: dual specificity tyrosine phosphorylation regulated kinase 3
• Alternate names: dual specificity tyrosine-phosphorylation-regulated kinase 3, dual specificity tyrosine-(Y)-phosphorylation regulated kinase 3, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 5, protein kinase Dyrk3, regulatory erythroid kinase,
• Gene location: 1q32.1 (206635535: 206655174)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine/threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specif
• OMIM: 603497

Protein Summary

• Protein general information: O43781  
  • Name: Dual specificity tyrosine phosphorylation regulated kinase 3 (EC 2.7.12.1) (Regulatory erythroid kinase) (REDK)
  • Length: 588  
  • Mass: 65714
  • Tissue specificity: Isoform 1
• Sequence:

  MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQ
  HFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQY
  KHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVAR
  VYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIK
  KNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFY
  RAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPR
  YCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKS
  VPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS

• Structural information:
  • Protein Domains: (209..52-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR042521  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 5Y86
  • PDBsum: 5Y86
  • STRING: ENSP00000356076
• Other Databases: GeneCards:  DYRK3  Malacards:  DYRK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035617	stress granule disassembly	IBA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IBA	biological process
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:1902751	positive regulation of cell cycle G2/M phase transition	IBA	biological process
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:1902751	positive regulation of cell cycle G2/M phase transition	IDA	biological process
GO:1903008	organelle disassembly	IDA	biological process
GO:0035063	nuclear speck organization	IDA	biological process
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0000242	pericentriolar material	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0035617	stress granule disassembly	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:1903432	regulation of TORC1 signaling	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0035617	stress granule disassembly	IMP	biological process
GO:0080135	regulation of cellular response to stress	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0004712	protein serine/threonine/tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator	IEA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0030218	erythrocyte differentiation	IDA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)