• Gene id: 84432

Gene Summary

• Gene Symbol: PROK1   Gene   UCSC   Ensembl
• Aliases: EGVEGF, PK1, PRK1
• Gene name: prokineticin 1
• Alternate names: prokineticin-1, EG-VEGF, black mamba toxin-related protein, endocrine-gland-derived vascular endothelial growth factor, mambakine,
• Gene location: 1p13.3 (110451165: 110457353)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene induces proliferation, migration, and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. It has little or no effect on a variety of other endothelial and
• OMIM: 606233

Protein Summary

• Protein general information: P58294  
  • Name: Prokineticin 1 (Endocrine gland derived vascular endothelial growth factor) (EG VEGF) (Mambakine)
  • Length: 105  
  • Mass: 11,715
• Sequence:

  MRGATRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKH
  HTCPCLPNLLCSRFPDGRYRCSMDLKNINF

• Structural information:
  • Interpro: IPR009523  IPR023569  
  • STRING: ENSP00000271331
• Other Databases: GeneCards:  PROK1  Malacards:  PROK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activity	IBA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001664	G-protein coupled receptor binding	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007623	circadian rhythm	IBA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0045765	regulation of angiogenesis	IBA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0000187	activation of MAPK activity	IBA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0001664	G-protein coupled receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007623	circadian rhythm	IBA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0045765	regulation of angiogenesis	IBA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0000187	activation of MAPK activity	IBA	biological process
GO:0001664	G-protein coupled receptor binding	IBA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007623	circadian rhythm	IBA	biological process
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0045765	regulation of angiogenesis	IBA	biological process

Diseases

Associated diseases	References
Chronic renal failure	GAD: 21085059
Embryo implantation	INFBASE: 26401590
Endometriosis	INFBASE: 20400074
Kallmann syndrome (KS)	INFBASE: 18596028
Oligozoospermia	MIK: 18596028
Germ cell development	MIK: 26192875
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Kallmann syndrome	MIK: 18596028
Oligozoospermia	MIK: 18596028

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18596028	Kallmann syndrome, persistent oligozoospermia			1 with Kallmann syndrome (KS), moderate oligozoospermia and normal testosterone levels	Male infertility	Prok-R2
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881