• Gene id: 84417

Gene Summary

• Gene Symbol: ECRG4   Gene   UCSC   Ensembl
• Aliases: C2orf40
• Gene name: ECRG4 augurin precursor
• Alternate names: augurin, esophageal cancer related gene 4 protein,
• Gene location: 2q12.2 (106063289: 106078154)     Exons: 7     NC_000002.12
• OMIM: 605271

Protein Summary

• Protein general information: Q9H1Z8  
  • Name: Augurin (Esophageal cancer related gene 4 protein) (ECRG4)
  • Length: 148  
  • Mass: 17183
  • Tissue specificity: Expressed in the brain, with expression in the epithelial cell layer of the choroid plexus (at protein level). {ECO
• Sequence:

  MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDR
  TRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYDDY

• Structural information:
  • Interpro: IPR028173  
  • STRING: ENSP00000238044
• Other Databases: GeneCards:  ECRG4  Malacards:  ECRG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070314	G1 to G0 transition	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0007417	central nervous system development	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0090398	cellular senescence	IBA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0070314	G1 to G0 transition	IEA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	IEA	biological process
GO:0090398	cellular senescence	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray